SecReT6
Protein ID: 225382183
SecReT6 ID794
T6SS typei5
Gene symbol-
Locus tagVEPGS_0617
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790777] [Browse all T6SS(s) in this replicon]
Location [Strand]18984..20483 [+]
Producthypothetical protein
NoteTssC
UniProt IDC0LZQ7, C0LZQ7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.80E-166, Aligned region: 61..493
Protein Sequence: 499 a.a.     [Download]
>gi|225382183|ref|ACN89323.1| hypothetical protein [Vibrio alginolyticus]
MSLNFRDPSKLKHEFSTGGYAELDSPWLTRFNESSDLVSSARIWLEGTRSRDLDSFRHSVMNTINRIDEL
LESQLNEILHHPEFQQLERGWVGVRYLCEQVDSHSSDSVKVKVLTATWNEISKDALKAIEFDQSALFKLL
YQNEYGMAGGEPFGVVVGDYQLRCDPSKNYFDRDLSVLSKISQSAAAAFSPFIMSASPEMFGVDSFAQLS
AIRDIAAQFEQEDYAKWRSLRDNDDAKFIGLTAPNVLFRQPYKSDGSRNDKFNFQEHIYDSNRDLLWGSS
AYCFAAVSIRAFQEHGWFTHMRGIKQGDYSQGIIVAPTRSKMRVNGKNDRERCPLNLKISERKEQELSEC
GFISISPIPETDMVGMTSNVSLYKPKQYAEKHISTNAKLTSMLQYTLCVSRVAHYLKVMGRDKISGYQDA
ESLERDFQRWLHQYTTASDEASDELRAKYPLNEAKITVREKRETPGHYYSVIHLRPHFQLDQMVSSIKLI
TELSPEHMV
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|225382166|gb|FJ790777|VEPGS_0617|:18984-20483
GTGTCACTTAACTTTCGCGACCCTAGCAAGCTAAAACATGAGTTCAGTACCGGAGGCTACGCTGAACTTG
ATAGCCCGTGGTTGACTCGATTCAATGAATCTTCTGATCTTGTATCGTCAGCGCGAATTTGGCTAGAAGG
TACACGTTCAAGAGATTTGGACAGCTTTCGTCATAGTGTGATGAACACAATTAACCGCATTGATGAGCTA
TTAGAATCTCAACTAAATGAAATATTACATCATCCTGAGTTTCAACAGCTCGAAAGGGGGTGGGTTGGAG
TTAGGTATTTATGTGAACAGGTTGATTCTCATTCATCGGATTCTGTAAAAGTTAAGGTTTTAACGGCGAC
ATGGAATGAAATCAGTAAAGATGCTTTAAAAGCCATCGAGTTTGACCAATCAGCACTATTTAAGTTGCTC
TATCAAAATGAATATGGGATGGCAGGGGGAGAACCCTTTGGTGTGGTGGTTGGAGATTATCAGCTTCGCT
GTGATCCTAGTAAAAATTATTTTGATAGAGATCTGTCTGTGTTGAGTAAGATCTCTCAGTCTGCAGCTGC
AGCATTCAGCCCATTTATCATGTCTGCATCGCCAGAGATGTTTGGTGTTGATAGTTTCGCTCAACTCTCT
GCGATAAGAGATATAGCGGCCCAATTTGAACAGGAAGATTATGCAAAGTGGCGTAGTTTGAGAGACAACG
ATGACGCTAAATTTATTGGTTTGACTGCACCTAACGTCTTGTTCCGTCAGCCATACAAAAGTGATGGCTC
GCGGAATGATAAATTCAATTTTCAAGAACACATCTACGACTCCAACCGAGATTTGCTATGGGGGAGTAGT
GCGTACTGTTTTGCTGCCGTATCAATTAGAGCATTTCAGGAACATGGTTGGTTCACGCATATGCGAGGGA
TTAAACAAGGCGATTACAGTCAGGGTATTATCGTCGCTCCTACAAGGAGCAAGATGCGTGTTAATGGCAA
GAATGATCGTGAAAGATGTCCGTTAAACTTGAAAATCTCTGAGAGAAAAGAACAAGAATTGTCTGAGTGC
GGTTTTATTTCTATTTCTCCAATACCTGAGACCGATATGGTGGGGATGACCTCGAATGTATCTCTCTACA
AGCCCAAACAATACGCAGAAAAGCATATTTCAACGAATGCAAAACTGACATCGATGTTGCAATACACATT
GTGTGTATCGCGAGTCGCACATTATCTCAAGGTTATGGGGCGTGACAAAATTAGTGGGTATCAAGACGCA
GAAAGCCTAGAGCGTGACTTTCAACGCTGGTTACATCAGTACACTACCGCATCAGATGAAGCGTCTGATG
AGCTTCGAGCTAAATACCCCCTAAATGAAGCGAAAATTACAGTTCGAGAGAAAAGAGAAACTCCTGGACA
TTATTACTCAGTTATCCATTTGCGACCGCATTTTCAACTCGATCAAATGGTATCTAGCATTAAATTAATT
ACCGAATTATCACCAGAGCACATGGTGTAA