SecReT6
Protein ID: 225382184
SecReT6 ID794
T6SS typei5
Gene symbol-
Locus tagVEPGS_0618
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790777] [Browse all T6SS(s) in this replicon]
Location [Strand]20494..21288 [+]
Producthypothetical protein
NoteTagJ
UniProt IDB1PDM1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.50E-41, Aligned region: 137..257
Protein Sequence: 264 a.a.     [Download]
>gi|225382184|ref|ACN89324.1| hypothetical protein [Vibrio alginolyticus]
MTQWKNALSQGLLQHALEQLIDEIKATPKDASLRSSFIELLCIDGDFERADAQLMQSIKLFPEYLPGASQ
LRHLVKAAQARKDFINGAASAKVLGDEELTKELVRFNLALGNQEYEEASRLSHRIEEHRTIKGFNVNGTN
YEDARDIDDRLGGYIELFSTAGNYFLVPISSIHTLEVKAPTSLLESIWRPVEFDIDGLGEGEGHMPLTYV
DSETDAQKLGRETDWKQIGEQESFVGLGQKCWLVDDSALPICDLTTLLEQKQIA
 
Nucleotide Sequence: 795 bp     [Download]
>gi|225382166|gb|FJ790777|VEPGS_0618|:20494-21288
ATGACTCAATGGAAAAATGCTTTGTCCCAAGGCCTATTGCAACACGCTCTAGAGCAATTAATTGATGAAA
TTAAAGCAACACCTAAAGATGCGAGCTTGAGAAGTTCCTTCATTGAGCTTCTGTGCATTGATGGTGACTT
CGAGCGTGCGGACGCTCAGCTCATGCAATCGATTAAATTGTTTCCTGAGTATCTGCCTGGTGCAAGTCAG
CTACGACATTTAGTGAAAGCAGCTCAAGCTAGAAAAGATTTTATCAATGGTGCGGCTAGTGCCAAAGTAT
TAGGTGATGAGGAATTAACTAAAGAGCTTGTTCGATTTAATCTTGCTCTCGGAAATCAAGAGTACGAAGA
AGCGTCACGTCTATCGCATCGCATTGAAGAGCATCGTACTATTAAAGGGTTTAACGTAAACGGCACAAAC
TACGAAGATGCTAGAGATATTGATGATCGTTTAGGTGGTTACATTGAACTGTTTTCTACAGCAGGTAACT
ATTTTCTTGTACCCATATCGAGCATCCATACGCTAGAAGTTAAAGCACCTACTTCTTTGTTAGAGAGTAT
TTGGCGACCTGTCGAGTTTGATATCGATGGACTTGGTGAAGGCGAAGGCCATATGCCGTTGACATATGTT
GACTCAGAGACCGATGCGCAAAAGTTAGGTCGAGAAACGGATTGGAAGCAGATTGGTGAGCAAGAATCTT
TTGTTGGCTTGGGTCAAAAATGTTGGTTAGTCGATGACTCAGCGCTTCCAATCTGTGATTTGACTACATT
ATTAGAACAGAAACAAATAGCGTAG