SecReT6
Protein ID: 225382185
SecReT6 ID794
T6SS typei5
Gene symbol-
Locus tagVEPGS_0619
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790777] [Browse all T6SS(s) in this replicon]
Location [Strand]21296..21760 [+]
Producthypothetical protein
NoteTssE
UniProt IDC0LZQ9, C0LZQ9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.10E-19, Aligned region: 28..129
Protein Sequence: 154 a.a.     [Download]
>gi|225382185|ref|ACN89325.1| hypothetical protein [Vibrio alginolyticus]
MSLTVSLLDKLIDSDPLTRDEKDFPASQQQMLSSLLRDLESMLNSRIGWKNIPDDLLEVRYSILNYGLPD
FFSMPYSSQEGQNQLCDIVHDAIKEFEPRLRNPHVQISDEKNAIDRVLRLQINATCLIDNSIHEVRFNSE
VEPVNLGMKLSRAK
 
Nucleotide Sequence: 465 bp     [Download]
>gi|225382166|gb|FJ790777|VEPGS_0619|:21296-21760
ATGTCGTTAACCGTTTCTCTGCTCGACAAATTGATAGATAGTGATCCTCTCACTCGAGATGAGAAAGACT
TCCCTGCAAGCCAGCAACAGATGTTGAGCAGCTTACTTAGAGATCTAGAGTCGATGCTGAATAGTCGTAT
TGGATGGAAAAATATTCCTGATGATCTTCTAGAGGTTCGTTATTCAATATTGAACTATGGGCTGCCAGAT
TTTTTCTCAATGCCCTATAGCAGCCAAGAAGGGCAGAATCAGCTTTGCGACATCGTTCATGATGCAATTA
AAGAGTTTGAGCCGAGGTTAAGGAACCCTCATGTCCAGATTTCGGACGAGAAAAACGCTATTGATAGGGT
ATTGAGGTTACAGATAAATGCCACTTGCTTAATTGATAACAGTATTCATGAAGTGCGATTCAATTCTGAA
GTAGAGCCGGTAAATTTAGGTATGAAACTGAGTAGAGCAAAATGA