SecReT6
Protein ID: 225382186
SecReT6 ID794
T6SS typei5
Gene symbol-
Locus tagVEPGS_0620
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790777] [Browse all T6SS(s) in this replicon]
Location [Strand]21757..23580 [+]
Producthypothetical protein
NoteTssF
UniProt IDB1A3G8, B1A3G8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.30E-191, Aligned region: 5..607
Protein Sequence: 607 a.a.     [Download]
>gi|225382186|ref|ACN89326.1| hypothetical protein [Vibrio alginolyticus]
MSEEFLKYYNRELAYLRHKGQEFGEQYPKIAARLRISEEQVDDPHVERLLEGCAFLTARIRQSLDNSYPQ
FTESLMGQLYPDFHAPIPSMSVIKMSCSNSTSSYFDVEEGERVVIGATGYHECEFRTCYPVRMYPVDVTS
GVFKNAPFKPVGSRWESNAHSVLKVQLTAQDEETPLGEMGIERLRFYLNGQSQLTFKLYQMLFQNLIGLS
VVVDGKEVRPLTQRHLSEVGFSEDEKVVPYSKRSFSGARLLVEYLHFPEKFMFFDITELGLSELDLGEQV
ELYFYFDTNDDWLPKQVDEESLMVGCVPVINLFKSIMEPKRILPTEYDYHLSPQYQEAESNEVVSISDVT
LRNWNKTYHNLPCYHAGEHTHYTNTSEIYWLMRREDKNWAGGYDEPGRETYISFVDKKHQLFSPDSRENW
LMYVEAECCNRNLAQKLPFGGGLPQVSLPEVNDNFESVRCLVSLSETIRPEMDESTRWQLTKLLTLNHFT
EEDGLATLKQTLNLYAFSGTAETKAVIDALTKLEFEPTTGRISQKGKVGFAHGIKIILTVSDQILPKEQI
FLLGSVLSVYFSQYAEINIFTQLEIRLKSTGKSFHVWPALTGDKVLL
 
Nucleotide Sequence: 1824 bp     [Download]
>gi|225382166|gb|FJ790777|VEPGS_0620|:21757-23580
ATGAGTGAAGAGTTTCTCAAGTACTATAATCGCGAGTTAGCTTATTTGCGTCACAAAGGGCAAGAGTTTG
GTGAGCAGTATCCCAAGATTGCCGCGAGACTTCGTATTAGTGAGGAACAGGTTGACGATCCACACGTAGA
AAGATTGTTAGAAGGCTGCGCATTTCTAACAGCAAGGATTAGACAAAGCTTAGACAATAGTTACCCTCAG
TTTACAGAGTCTTTGATGGGACAGTTATATCCGGATTTTCACGCCCCAATCCCGTCAATGTCAGTCATTA
AAATGAGCTGTTCTAACTCCACTTCCTCTTATTTCGATGTAGAAGAAGGCGAGCGAGTTGTTATCGGTGC
TACTGGATATCATGAATGCGAGTTTAGAACTTGTTATCCGGTCAGAATGTATCCTGTTGATGTGACCTCT
GGCGTTTTTAAAAATGCGCCTTTCAAGCCAGTTGGCTCACGATGGGAAAGCAATGCTCATTCAGTTTTGA
AAGTACAGCTCACGGCTCAAGATGAAGAGACTCCTCTTGGTGAAATGGGGATAGAACGGCTGCGCTTCTA
TTTAAACGGTCAATCTCAATTGACTTTTAAGCTCTACCAAATGCTGTTTCAAAACCTAATTGGTTTATCT
GTTGTTGTGGATGGCAAAGAAGTTCGTCCTTTAACCCAAAGACATCTTTCTGAAGTAGGATTTTCAGAAG
ATGAGAAAGTTGTGCCATACAGTAAAAGAAGCTTTTCAGGAGCAAGATTACTTGTTGAGTATTTGCACTT
TCCTGAGAAGTTTATGTTCTTTGATATCACCGAACTTGGATTATCTGAGCTAGATCTTGGAGAGCAAGTC
GAGCTGTATTTTTACTTTGATACCAACGATGACTGGCTTCCAAAGCAAGTGGACGAAGAAAGCTTAATGG
TAGGTTGTGTGCCTGTAATCAACTTATTTAAAAGTATTATGGAGCCTAAGCGTATTCTACCAACTGAATA
CGATTACCACTTGTCTCCACAATACCAAGAAGCTGAAAGTAATGAGGTTGTCTCAATTTCTGACGTAACG
TTGAGAAACTGGAACAAAACGTACCACAATTTGCCATGTTATCACGCTGGTGAGCACACGCATTATACGA
ACACTAGTGAGATTTATTGGTTGATGAGACGTGAGGATAAGAACTGGGCTGGTGGGTATGATGAGCCAGG
TAGAGAAACTTACATTTCTTTTGTTGATAAAAAACATCAATTGTTCAGCCCGGATAGCCGGGAAAACTGG
TTAATGTACGTGGAAGCTGAGTGCTGTAACCGCAACTTAGCGCAGAAACTTCCATTTGGAGGTGGGCTGC
CGCAAGTATCTTTACCGGAGGTAAATGACAATTTCGAATCTGTTCGTTGTTTAGTTTCTTTATCAGAAAC
CATTCGGCCAGAAATGGATGAAAGCACACGATGGCAGTTAACTAAGCTTTTAACTTTAAACCATTTTACC
GAGGAAGATGGTTTAGCAACTTTGAAGCAGACCCTTAATCTCTATGCATTTTCTGGGACAGCAGAAACGA
AAGCGGTAATCGATGCTTTAACTAAGTTAGAGTTTGAGCCTACTACAGGAAGAATTAGTCAGAAAGGTAA
AGTTGGATTTGCGCACGGTATAAAAATTATTTTGACGGTTTCTGATCAAATTTTACCTAAAGAGCAGATC
TTTCTCTTAGGTAGTGTTTTATCTGTTTACTTCTCGCAATATGCTGAAATTAACATTTTTACGCAGTTAG
AAATAAGACTTAAGTCCACGGGAAAGTCTTTCCACGTATGGCCCGCATTAACTGGCGATAAGGTGTTGCT
ATGA