SecReT6
Protein ID: 225382187
SecReT6 ID794
T6SS typei5
Gene symbol-
Locus tagVEPGS_0621
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790777] [Browse all T6SS(s) in this replicon]
Location [Strand]23577..24245 [+]
Producthypothetical protein
NoteTssG
UniProt IDC0LZR1, C0LZR1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-45, Aligned region: 8..209
Protein Sequence: 222 a.a.     [Download]
>gi|225382187|ref|ACN89327.1| hypothetical protein [Vibrio alginolyticus]
MSAEQFYRELKQHPLFEAIHLIEHEVLQAEAQIGTDALPKHEKLNLKVNPSLGLENAQLCELKNIDDNEL
EIETNLIGLTGEQGVLPQHYSELALHRQKEGDTAMVDFYDIFNHRLLSLYYRCWQLSQLTVQSRAHAQGA
RSPLESCKSALTGEGSSLSRHYGGVFASPMRSKGGLKSILECLSGCQVKFMNFKDNGYTLRKKSKHALHP
ELCLKGSLLNLV
 
Nucleotide Sequence: 669 bp     [Download]
>gi|225382166|gb|FJ790777|VEPGS_0621|:23577-24245
ATGAGCGCGGAACAGTTTTATCGAGAATTAAAGCAACATCCATTGTTTGAAGCGATTCATCTTATTGAAC
ACGAAGTTCTGCAAGCAGAGGCGCAAATAGGAACAGATGCGTTACCGAAGCATGAAAAGCTAAACTTAAA
GGTTAATCCATCATTAGGTCTTGAAAATGCTCAGCTTTGTGAACTGAAAAATATAGATGACAACGAGTTA
GAGATTGAGACCAATTTAATTGGCCTAACGGGTGAGCAAGGTGTGCTTCCCCAGCACTATAGTGAATTAG
CTTTACATCGCCAAAAAGAAGGCGATACGGCTATGGTGGACTTCTACGATATTTTCAATCATCGCTTATT
ATCTCTTTATTATCGATGTTGGCAACTGAGTCAGCTGACTGTTCAGTCTCGTGCGCATGCGCAGGGCGCG
CGTTCGCCGTTAGAAAGCTGTAAATCGGCATTAACTGGGGAAGGGAGTTCACTGTCCCGGCACTATGGTG
GTGTGTTTGCTTCACCAATGAGAAGTAAAGGTGGACTAAAAAGTATTCTTGAATGTTTATCTGGATGCCA
AGTAAAGTTCATGAATTTCAAGGACAATGGTTACACCTTACGAAAGAAGAGCAAACACGCCTTGCATCCC
GAACTATGCCTGAAGGGCAGTTTGCTCAACTTGGTTTAG