SecReT6
Protein ID: 225382190
SecReT6 ID794
T6SS typei5
Gene symbol-
Locus tagVEPGS_0624
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790777] [Browse all T6SS(s) in this replicon]
Location [Strand]27857..28789 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDC0LZR4, C0LZR4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-56, Aligned region: 30..308
ERF [PF04404], Evalue: 0.0046, Aligned region: 126..153
ERF [PF04404], Evalue: 0.0046, Aligned region: 149..236
Protein Sequence: 310 a.a.     [Download]
>gi|225382190|ref|ACN89330.1| Rhs element Vgr protein [Vibrio alginolyticus]
MKRATQDNNFIRISSPFDKDAIILNSFEYREEISELFSLRAKAYFNDQRSELNEIIGKEVTITLENSEDV
SSNPRYMHGYVSAARLEGKRVSNTHKGENYKNIELLIEPKLRFAEYRKNCRIFQHKDIKEIISEVLSEHS
VAFSFELTKSYPKYTYKVQYEESDLEFVRRLLSEEGLSFCFTHTKSAHTLNIFDDISFYKPGTEFLVDFD
TGTAKSSHISSWHETQILTTKASQKSGYNMLKPSSNPKNAAKGESDFFTVPGSEYFEYMGEMESNDQYAL
RNTHAIEALQQNAYLCRGEATCRTFSVNTH
 
Nucleotide Sequence: 933 bp     [Download]
>gi|225382166|gb|FJ790777|VEPGS_0624|:27857-28789
ATGAAAAGAGCAACTCAAGATAACAATTTCATCCGAATTTCTTCGCCATTCGATAAAGATGCCATCATAC
TAAACTCGTTTGAGTATAGAGAAGAGATCTCAGAACTTTTTTCATTGCGTGCTAAAGCTTACTTTAATGA
TCAACGAAGTGAATTAAACGAAATTATTGGTAAGGAGGTTACCATTACCCTTGAAAATAGTGAGGATGTT
TCTTCAAATCCTCGTTATATGCATGGTTATGTTTCTGCTGCAAGATTAGAAGGGAAAAGGGTTTCTAATA
CACATAAAGGCGAAAATTATAAAAACATAGAATTATTAATAGAGCCTAAATTACGTTTCGCTGAATATCG
AAAAAATTGCAGAATATTTCAGCATAAAGATATAAAGGAAATTATCTCTGAAGTACTATCGGAGCATAGT
GTTGCCTTTAGTTTTGAGTTAACCAAGTCCTATCCTAAATACACATACAAAGTACAATATGAAGAATCAG
ATCTTGAATTTGTTCGACGTCTGTTATCGGAGGAGGGGCTATCATTTTGTTTTACACATACTAAGTCTGC
CCATACGCTCAATATTTTTGATGACATCAGCTTTTATAAGCCGGGTACTGAGTTTTTAGTCGATTTTGAT
ACAGGTACGGCGAAATCTAGCCACATTTCTTCTTGGCATGAAACGCAAATTCTGACTACTAAAGCGAGTC
AAAAGTCAGGCTATAACATGCTCAAGCCTTCTTCGAATCCTAAAAATGCTGCAAAGGGTGAAAGTGATTT
TTTTACAGTACCTGGAAGCGAGTATTTTGAATACATGGGTGAAATGGAGAGCAATGATCAATACGCACTG
AGAAACACGCATGCAATAGAAGCACTACAGCAAAATGCATATTTGTGTCGTGGCGAGGCTACGTGCAGAA
CATTCAGTGTCAATACGCACTGA