SecReT6
Protein ID: 225791094
SecReT6 ID794
T6SS typei5
Gene symbol-
Locus tagVEPGS_0608
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790777] [Browse all T6SS(s) in this replicon]
Location [Strand]6921..7685 [+]
Producthypothetical protein
NoteFha
UniProt IDC0LZP8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 254 a.a.     [Download]
>gi|225791094|ref|ACN89314.2| hypothetical protein [Vibrio alginolyticus]
MGQGNEIALSDDDMVSLGDYQISVSIQTDTDVFSLETSKSLSSAPPEVVSSPSEAEFVDLGLSASELLNE
SVPSDFQLDIGLVDDFIDIPKPEKQSTVSETLPKVNRQSEHLSTPNFDTNGGELAAFVRGVGIDPMMIPS
DNREEWFEQLGESFSLMLVGLMETLHNRAVFKQTNRLSHTAFRKSENNPLKFSANLEDAIHNLYNRQTAS
FLKPNAAIKEAFNDIESHEQALMKGVEGTVSSVVMKSFTNIFCY
 
Nucleotide Sequence: 765 bp     [Download]
>gi|225382166|gb|FJ790777|VEPGS_0608|:6921-7685
GTGGGTCAAGGAAATGAAATAGCACTAAGCGATGACGATATGGTTAGCTTAGGGGATTATCAAATTTCAG
TTTCTATTCAAACAGATACAGATGTATTCAGTCTTGAGACAAGTAAAAGTCTTTCTAGCGCACCCCCTGA
AGTAGTCTCAAGTCCATCGGAAGCAGAATTTGTTGACCTAGGCCTTAGTGCTAGTGAACTCTTAAACGAA
AGTGTTCCTTCTGACTTTCAGCTAGATATTGGTTTAGTCGATGATTTTATTGATATCCCAAAGCCCGAAA
AACAGAGCACCGTATCTGAAACTTTACCGAAAGTTAACCGACAATCAGAACACCTATCGACTCCCAACTT
TGATACCAATGGGGGTGAACTTGCGGCTTTTGTTAGAGGGGTGGGTATAGATCCAATGATGATTCCCAGC
GATAACCGAGAGGAATGGTTCGAACAACTGGGGGAGTCATTTTCTTTGATGCTAGTTGGTTTAATGGAAA
CACTGCATAACAGAGCAGTGTTTAAACAAACAAATCGACTTAGTCATACCGCATTTCGTAAGTCAGAAAA
TAACCCTTTAAAGTTTTCTGCAAACTTAGAAGATGCGATTCATAACTTATATAACCGTCAAACCGCTAGC
TTCTTAAAGCCAAATGCAGCCATTAAAGAAGCATTTAATGACATCGAAAGTCATGAGCAAGCCTTAATGA
AAGGTGTTGAAGGTACGGTTTCGAGTGTGGTGATGAAAAGTTTTACCAATATATTTTGTTATTAA