SecReT6
Protein ID: 225791095
SecReT6 ID794
T6SS typei5
Gene symbol-
Locus tagVEPGS_0609
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790777] [Browse all T6SS(s) in this replicon]
Location [Strand]08163..9452 [+]
Producthypothetical protein
NoteTssK
UniProt IDC0LZP9, C0LZP9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-134, Aligned region: 7..427
Protein Sequence: 429 a.a.     [Download]
>gi|225791095|ref|ACN89315.2| hypothetical protein [Vibrio alginolyticus]
MFLRPQHFQQQERATSQEFKGLHQLGGAYNWGVWKCRVKKHALKDGLIELEHLEAVLPDMTLVNTLISND
SVSPLLIDKNTENTLVKITLPLSSVTGKNVSDVSESIVSRYVLQDIDVIDNLTGQDEETIQVAALNLELK
ASNDKLAGYVELPILRIKEVTPEGEVILDDEYVPPLINLLSDKVMSAYLRNVIAMTKMRADVIAQRLIKG
KSASASAVDFIMLQMLNRYEAKLKHFSELDRLHPLELATTLKGYIGELATFSNKTKRVPSLLAYDHLDVS
SVYSELNQILSQYLSVVLDQTATKLPLEPRQYGIQVTPLPDKRLLESCQFVLAIKADTTTDEIRRLVPAQ
LKFGPAEQIRDLINNQINGINVVPLSVVPRQIPYQTGYVYFEVVKKGPFWMRLKDSGGIALHLSGHFPNA
ELELWSINQ
 
Nucleotide Sequence: 1290 bp     [Download]
>gi|225382166|gb|FJ790777|VEPGS_0609|:8163-9452
ATGTTTTTACGTCCCCAGCACTTCCAACAACAAGAACGCGCAACCTCTCAAGAATTCAAGGGCTTACATC
AGTTAGGTGGGGCTTACAATTGGGGAGTTTGGAAATGTCGAGTAAAAAAACACGCGCTAAAAGATGGTCT
TATTGAACTTGAGCATCTTGAAGCTGTTTTGCCAGATATGACGTTGGTTAATACGTTAATATCCAACGAT
TCAGTTTCGCCTCTACTTATTGATAAAAACACTGAAAATACGTTAGTAAAAATAACTCTCCCTCTTTCAA
GTGTTACAGGTAAAAACGTTTCGGATGTAAGCGAATCGATCGTCTCTCGTTATGTACTTCAAGATATCGA
CGTGATAGATAACCTTACAGGACAAGATGAGGAAACCATCCAAGTTGCAGCCCTTAACCTAGAGTTGAAA
GCGAGTAATGACAAATTAGCGGGTTATGTGGAGTTACCTATCTTAAGGATCAAAGAGGTAACTCCTGAAG
GGGAAGTTATACTAGACGATGAGTACGTTCCTCCGCTTATCAATCTCCTTAGCGACAAAGTTATGTCAGC
CTATCTACGTAACGTTATCGCGATGACAAAGATGCGTGCTGACGTTATTGCGCAGCGCTTGATTAAGGGT
AAATCTGCATCGGCATCTGCTGTTGATTTCATTATGCTACAAATGCTGAACCGATATGAGGCTAAGTTAA
AGCATTTCAGTGAGTTAGATAGGTTACATCCACTGGAATTAGCGACGACACTTAAAGGTTACATTGGTGA
GTTAGCCACTTTTTCTAATAAAACTAAAAGAGTCCCAAGTTTGCTTGCGTATGATCACTTAGATGTATCA
AGTGTCTATAGCGAGTTGAATCAGATACTCAGTCAGTACCTCAGTGTTGTTCTTGACCAAACTGCGACCA
AACTTCCGTTGGAGCCTCGCCAGTACGGTATTCAAGTGACGCCACTTCCAGATAAACGCTTGCTTGAGTC
ATGCCAATTTGTGCTAGCAATTAAAGCAGATACCACAACAGATGAAATAAGACGCCTGGTCCCAGCGCAA
CTCAAGTTTGGCCCCGCAGAGCAGATTCGCGATCTAATTAATAATCAGATCAACGGTATAAACGTAGTGC
CGTTGAGTGTCGTCCCGAGACAGATTCCTTACCAAACGGGCTATGTCTATTTCGAAGTTGTCAAGAAAGG
GCCATTTTGGATGAGGCTAAAAGATAGTGGCGGTATTGCGCTTCACCTATCAGGGCATTTTCCGAATGCT
GAACTTGAGCTTTGGAGTATTAATCAATAG