SecReT6
Protein ID: 225791096
SecReT6 ID794
T6SS typei5
Gene symbol-
Locus tagVEPGS_0625
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790777] [Browse all T6SS(s) in this replicon]
Location [Strand]28759..29784 [+]
Producthypothetical protein
NoteTssI
UniProt IDC0LZR5, C0LZR5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 3.70E-25, Aligned region: 107..200
Phage_GPD [PF05954], Evalue: 2.20E-05, Aligned region: 14..65
Protein Sequence: 341 a.a.     [Download]
>gi|225791096|ref|ACN89331.2| hypothetical protein [Vibrio alginolyticus]
MQNIQCQYALRNTHAIEALQQNAYLCRGEATCRTFSVGKCFKFKKHEDKSRVGKEYVLSSVFLSAAVYNQ
TGQGGTGAQGVKVSFSCVDSKTILRPSVNYPKPQMKGLQTAVVTGNKDGEIYIDKHGRIKVQFHWDRVGK
YDVNSSCWIRVAQNIAGNGWGSVFHPRVGQEVIVEFVNGDPDQPIVTGSLYNGSQLPPYALPEQSSQSGY
KSRSVQKGTSNFNELRFDDKPGEEHIYLHAEKLFQMLVEDCVDIAVENSKTEKVTNDVNQEVGQNASLKV
GKNFSNETGEVLSFNAGKSVEIKVGGASIQMSSSGEINIKGNKISINGSAIALKAGQISLN
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|225382166|gb|FJ790777|VEPGS_0625|:28759-29784
GTGCAGAACATTCAGTGTCAATACGCACTGAGAAACACGCATGCAATAGAAGCACTACAGCAAAATGCAT
ATTTGTGTCGTGGCGAGGCTACGTGCAGAACATTCAGTGTGGGCAAGTGCTTCAAGTTTAAAAAGCATGA
AGATAAATCTCGAGTCGGCAAAGAATATGTACTGTCTTCTGTTTTTTTGTCTGCTGCTGTTTATAACCAG
ACTGGTCAAGGTGGGACCGGTGCGCAAGGTGTCAAAGTCTCGTTTAGTTGTGTTGACTCAAAGACAATCC
TGCGTCCTTCAGTTAACTACCCGAAACCTCAGATGAAAGGTTTGCAAACCGCAGTAGTTACGGGGAACAA
AGATGGTGAAATTTACATAGACAAACATGGCCGTATCAAAGTTCAGTTTCACTGGGACCGTGTTGGTAAA
TACGATGTAAATAGTTCATGTTGGATTCGTGTTGCGCAAAATATTGCAGGTAACGGATGGGGGTCGGTGT
TTCACCCTAGAGTCGGACAAGAGGTCATCGTCGAGTTTGTTAACGGAGACCCTGATCAACCAATCGTTAC
GGGGTCACTATATAACGGTAGTCAACTCCCTCCTTACGCTTTACCAGAGCAAAGTTCTCAGAGTGGTTAT
AAATCACGCTCTGTACAAAAAGGTACATCCAATTTTAATGAGTTGCGCTTCGATGATAAGCCTGGTGAAG
AGCACATTTATCTTCATGCTGAAAAACTGTTCCAAATGCTAGTTGAAGACTGTGTTGATATCGCTGTTGA
AAACAGTAAAACCGAAAAAGTGACCAATGATGTTAATCAAGAGGTTGGTCAGAACGCGAGCTTGAAAGTA
GGTAAAAACTTTTCGAATGAAACGGGTGAAGTACTGTCTTTTAATGCAGGAAAGAGCGTCGAGATCAAAG
TAGGTGGTGCTTCTATTCAGATGTCTAGCTCTGGAGAAATCAATATCAAAGGTAATAAAATATCCATTAA
CGGCTCAGCTATTGCTCTTAAAGCTGGGCAAATTTCATTGAACTAA