SecReT6
Protein ID: 226229272
SecReT6 ID332
T6SS typei4b
Gene symbol-
Locus tagGAU_3866
StrainGemmatimonas aurantiaca T-27
Repliconchromosome [GenBank: NC_012489] [Browse all T6SS(s) in this replicon]
Location [Strand]4557043..4557771 [-]
Producthypothetical protein
NoteTssL
UniProt IDC1AEI1
KEGG IDgau:GAU_3866
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-47, Aligned region: 12..216
Protein Sequence: 242 a.a.     [Download]
>gi|226229272|ref|YP_002763378.1| hypothetical protein GAU_3866 [Gemmatimonas aurantiaca T-27]
MTVTTTAAPGRLASALQEALTAVVRLRADRQPVPDAAAFRAQIVQMLARAEQDALQMGYSTQDARLAIFA
IVAFLDESVLNTRVPALAEWARRPLQDELFGGHMGGEWFFQHIDQLLARPDSVELAELLEVYQLCLLLGF
RGKFGAGDNGQLYAITTKVAERLSRLRRVGGDLAPHWQPPADRVDARDPWLRPLAMAAIGTVIVLFVLWG
TYAFTLRGGTDAVRALAPAPSSTTAATTSVAR
 
Nucleotide Sequence: 729 bp     [Download]
>ref|NC_012489.1|:c4557771-4557043 hypothetical protein GAU_3866 [Gemmatimonas aurantiaca T-27]
GTGACCGTAACGACGACTGCCGCGCCGGGGCGGCTGGCGAGTGCCCTGCAGGAAGCGCTCACGGCGGTGG
TGCGCCTGCGCGCCGATCGGCAGCCGGTGCCCGATGCGGCGGCCTTTCGCGCCCAGATCGTGCAGATGCT
CGCGCGGGCCGAACAGGACGCGCTGCAGATGGGCTACAGCACGCAGGATGCCCGGCTGGCGATCTTCGCC
ATCGTGGCCTTCCTCGACGAATCGGTGCTGAACACACGCGTGCCGGCGCTGGCGGAATGGGCGCGACGTC
CACTGCAGGACGAGCTGTTTGGTGGCCACATGGGTGGTGAGTGGTTCTTTCAGCACATCGATCAACTGCT
CGCGCGCCCGGACAGTGTGGAGTTGGCGGAGTTGCTCGAGGTCTATCAGTTGTGTCTGCTGCTCGGCTTC
CGCGGAAAGTTCGGCGCGGGTGACAACGGCCAGTTGTATGCGATCACGACCAAGGTGGCCGAGCGTTTGA
GCCGACTGCGTCGTGTGGGCGGTGATCTGGCGCCGCACTGGCAGCCGCCGGCCGACCGGGTGGATGCGCG
CGATCCGTGGTTGCGTCCATTGGCGATGGCGGCCATCGGGACGGTGATTGTGCTGTTCGTGTTGTGGGGC
ACCTATGCGTTCACGCTGCGTGGTGGCACCGATGCGGTGCGCGCGCTGGCTCCGGCTCCTTCATCGACGA
CGGCTGCGACGACTTCGGTCGCCCGCTGA