SecReT6
Protein ID: 226229273
SecReT6 ID332
T6SS typei4b
Gene symbol-
Locus tagGAU_3867
StrainGemmatimonas aurantiaca T-27
Repliconchromosome [GenBank: NC_012489] [Browse all T6SS(s) in this replicon]
Location [Strand]4557848..4559227 [-]
Producthypothetical protein
NoteTssK
UniProt IDC1AEI2
KEGG IDgau:GAU_3867
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.40E-109, Aligned region: 23..454
Protein Sequence: 459 a.a.     [Download]
>gi|226229273|ref|YP_002763379.1| hypothetical protein GAU_3867 [Gemmatimonas aurantiaca T-27]
MQLTSPPSRRVVWEDGMHLTPQHFQAQRRYHEEQTARTLGYMMPFAFGLSAITVDDDGLRNGTFSLVQAR
GVLPDGTVFHLPDADEAPDPVAVAERFSPTRDAHVVYLALAPWRPDAANVQASALDAPARFRTREEVVSD
ESTGTDPLAIQFAARNLRILFDEEVTDDVVALPIARIRRDGRGQFQLDGSFVPPCVQLAASDRLLTLARD
IVGLLEAKGGALVATLSQAPSGAAGGSAAYMGNELATRWLLHAVRSADAPLRHLLLTRRAHPERLYGELA
RLAGALCTFSMTSHPKDVPLYDHLSPTDTFDALERLLRAHLDVVISARALVIPLQHTSDLLHVGAISDPR
CFEPGVRWFLGVRADLGQADLIDRMQRLTKTCASKFVLELVRRAFNGLATEHIPSPPSGLAPKPDLTYFE
LTVAGPCGVSLQDSREVGVYVPEALPGAYIELAVLLPPS
 
Nucleotide Sequence: 1380 bp     [Download]
>ref|NC_012489.1|:c4559227-4557848 hypothetical protein GAU_3867 [Gemmatimonas aurantiaca T-27]
GTGCAACTGACGTCGCCGCCGTCCCGCCGTGTCGTCTGGGAAGACGGCATGCATCTGACGCCGCAACACT
TCCAGGCGCAGCGCCGGTATCACGAAGAACAGACCGCGCGCACGCTGGGCTACATGATGCCGTTTGCCTT
CGGTCTGTCCGCCATCACGGTGGACGATGACGGCTTGCGCAATGGTACGTTCTCGCTGGTGCAGGCCCGC
GGTGTGTTGCCCGATGGAACGGTGTTTCACCTGCCGGATGCCGATGAAGCGCCCGATCCGGTCGCCGTCG
CCGAACGATTCTCGCCGACGCGTGATGCGCACGTGGTGTACCTCGCGCTCGCCCCGTGGCGTCCCGATGC
GGCCAACGTACAGGCCTCGGCACTCGATGCGCCAGCGCGCTTTCGTACGCGCGAGGAAGTCGTCAGCGAC
GAGTCCACCGGCACCGATCCGCTGGCTATCCAGTTCGCGGCGCGCAATCTGCGGATCCTCTTCGACGAAG
AGGTGACCGACGATGTGGTGGCACTGCCGATCGCACGGATCCGGCGTGATGGGCGTGGGCAATTCCAGCT
CGATGGGAGCTTCGTCCCGCCCTGTGTGCAGTTGGCGGCGAGCGATCGTCTGCTGACCCTCGCGCGGGAT
ATCGTTGGTCTGTTGGAAGCCAAGGGCGGCGCGCTCGTGGCGACGCTGTCACAGGCCCCGTCCGGGGCGG
CGGGCGGCAGTGCCGCCTACATGGGCAACGAGCTCGCCACACGCTGGTTGCTGCATGCGGTCCGATCGGC
TGATGCGCCGCTCCGCCATCTGCTGCTGACGCGCCGTGCGCACCCGGAGCGGTTGTACGGAGAGCTGGCC
CGATTGGCCGGAGCGCTGTGCACGTTTTCGATGACCAGTCATCCGAAGGACGTGCCACTCTATGATCATC
TCTCGCCCACGGATACTTTCGACGCGCTCGAGCGTCTCTTGCGGGCACATCTCGATGTCGTGATTTCGGC
GCGTGCGCTGGTGATCCCGCTGCAGCACACGTCCGACCTGCTGCATGTGGGGGCGATCAGCGATCCTCGC
TGCTTCGAGCCGGGCGTACGCTGGTTCCTGGGCGTACGAGCCGATCTGGGGCAGGCCGATCTCATCGATC
GCATGCAGCGGCTGACAAAAACGTGTGCGAGCAAGTTTGTGCTCGAACTGGTGCGTCGCGCGTTCAATGG
ATTGGCCACGGAACACATCCCGTCGCCGCCATCGGGCTTGGCGCCGAAGCCGGATCTGACGTATTTCGAG
CTGACGGTGGCCGGGCCCTGCGGCGTGTCGCTGCAGGACAGTCGTGAAGTGGGAGTGTATGTCCCCGAAG
CATTGCCCGGTGCGTACATCGAACTCGCCGTGTTGTTGCCTCCTTCCTGA