SecReT6
Protein ID: 226229275
SecReT6 ID332
T6SS typei4b
Gene symbol-
Locus tagGAU_3869
StrainGemmatimonas aurantiaca T-27
Repliconchromosome [GenBank: NC_012489] [Browse all T6SS(s) in this replicon]
Location [Strand]4561442..4562788 [-]
Producthypothetical protein
NoteTssK
UniProt IDC1AEI4
KEGG IDgau:GAU_3869
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-117, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|226229275|ref|YP_002763381.1| hypothetical protein GAU_3869 [Gemmatimonas aurantiaca T-27]
MRHLPPVLWTKGVLLTPQHLQAQDRHHEEALAFQVSALTFCPWGVSQIAFDQAALTGGTLVVNAVTGRFP
DGLLFDAPLTGPTPPPKVVSAAFAPDQRSLLVYLAVPEYRPGARNVARLGDAVPTRWHSDEQLTRDETTG
LTERPIQVAPPTLRLLLEGESLEGYTAMPIARLVQGPAGDIAFDHAFVPPLLDVLASDALSAMMRRLVER
LSARSASLAGSRRQRNTDLADFSVADVGSFWLLYTINTHLPALRHLQEVRRGHPSALWESMLALVGALSA
FATTADARTLPTYDHLRLGECFAELERRLFELLDGAVVDSAVSLPLKAVRPTLHAVAVEQAAWLDAPQWF
LAVSAPLRQQDLITKVMQGCKVGSADVVDTLIRQALPGIELAHVSAPPPAVPVKLDFQYFAIRKAGGAWD
AISRARNLAVYVPAELVDARFELVIVLR
 
Nucleotide Sequence: 1347 bp     [Download]
>ref|NC_012489.1|:c4562788-4561442 hypothetical protein GAU_3869 [Gemmatimonas aurantiaca T-27]
ATGCGCCACTTGCCACCAGTACTCTGGACGAAGGGTGTCCTGCTCACGCCGCAGCATCTGCAGGCGCAGG
ATCGTCACCACGAAGAAGCGCTCGCGTTCCAGGTGAGTGCCCTGACGTTCTGTCCATGGGGCGTCTCGCA
GATCGCCTTCGATCAAGCGGCGCTGACCGGCGGCACGCTGGTCGTGAATGCCGTCACCGGACGGTTCCCC
GACGGTCTGCTCTTCGACGCACCGCTCACGGGGCCCACGCCACCACCCAAAGTGGTTTCTGCCGCGTTTG
CCCCCGATCAACGGTCGCTGCTGGTGTATCTCGCGGTGCCGGAATATCGACCCGGTGCGCGCAATGTGGC
CCGATTGGGCGATGCCGTCCCCACGCGCTGGCACTCGGACGAGCAGCTCACCCGCGACGAGACGACGGGA
CTCACCGAGCGGCCGATCCAGGTGGCACCACCCACCTTACGTCTGCTGCTCGAGGGAGAAAGCCTCGAGG
GATACACGGCCATGCCCATCGCCCGACTGGTGCAGGGGCCGGCCGGCGACATCGCCTTCGATCATGCGTT
CGTCCCGCCACTGCTGGATGTGCTTGCCAGCGATGCGCTCAGTGCCATGATGCGGCGACTCGTCGAACGG
CTCTCGGCGCGCAGCGCCTCGCTCGCCGGCAGCCGGCGTCAGCGCAACACCGACCTGGCCGATTTCTCCG
TGGCCGACGTGGGCAGCTTCTGGTTGTTGTACACGATCAACACTCATCTGCCGGCGCTGCGACACCTGCA
GGAGGTGCGTCGCGGGCATCCATCGGCGTTGTGGGAATCGATGCTGGCGTTGGTGGGGGCGCTCTCAGCC
TTTGCCACCACCGCCGACGCCCGCACGCTGCCCACCTACGACCATCTCCGCCTCGGTGAGTGTTTTGCTG
AACTGGAGCGGCGCCTGTTCGAGTTGCTCGACGGGGCGGTGGTCGACTCGGCCGTGTCGTTGCCGCTCAA
GGCGGTGCGCCCCACGCTGCACGCGGTGGCGGTGGAACAGGCGGCCTGGCTCGATGCGCCGCAGTGGTTC
CTAGCGGTGAGCGCGCCCCTGCGTCAGCAGGACCTGATCACGAAGGTCATGCAGGGGTGCAAGGTGGGTT
CGGCCGATGTGGTGGACACACTCATTCGACAGGCGCTGCCGGGTATCGAACTGGCGCATGTGTCAGCGCC
GCCACCAGCGGTGCCGGTGAAGCTCGACTTCCAGTACTTCGCCATCCGGAAGGCCGGTGGGGCTTGGGAC
GCCATTTCGCGGGCCCGCAACCTGGCCGTCTACGTGCCCGCCGAACTGGTGGACGCGCGGTTCGAACTGG
TGATCGTGCTACGATAG