SecReT6
Protein ID: 226229276
SecReT6 ID332
T6SS typei4b
Gene symbol-
Locus tagGAU_3870
StrainGemmatimonas aurantiaca T-27
Repliconchromosome [GenBank: NC_012489] [Browse all T6SS(s) in this replicon]
Location [Strand]4563095..4563601 [+]
Producthypothetical protein
NoteTssB
UniProt IDC1AEI5
KEGG IDgau:GAU_3870
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.20E-56, Aligned region: 9..166
Protein Sequence: 168 a.a.     [Download]
>gi|226229276|ref|YP_002763382.1| hypothetical protein GAU_3870 [Gemmatimonas aurantiaca T-27]
MADSTQKKLERVRPPRIQISYEVETGGAIEMKELPFLMGVLGDFSGNPAEPLPRLKDRKFVEINPDNFDD
TLASMKPRLQIAVENKLSDDENAPKLGVELNFRSMDDFNPENVAKQVKPLRELLDLRTELSNLRANLQTN
EKLDEVLQDTLGNADKMAKLKSELGLES
 
Nucleotide Sequence: 507 bp     [Download]
>ref|NC_012489.1|:4563095-4563601 hypothetical protein GAU_3870 [Gemmatimonas aurantiaca T-27]
ATGGCCGACAGTACCCAGAAGAAACTGGAGCGCGTCCGTCCCCCCCGCATTCAGATCTCCTACGAGGTTG
AAACGGGTGGCGCCATCGAAATGAAGGAGCTCCCGTTCCTCATGGGCGTCCTCGGGGATTTCAGCGGTAA
CCCTGCTGAACCGCTGCCGCGGTTGAAAGATCGCAAGTTCGTCGAAATCAATCCGGACAACTTCGACGAC
ACCCTCGCCAGCATGAAGCCGCGCCTGCAGATCGCCGTCGAGAACAAGCTCTCCGACGACGAGAACGCGC
CGAAGCTCGGTGTGGAGCTGAACTTCCGCAGCATGGACGACTTCAACCCGGAAAACGTGGCGAAGCAGGT
GAAGCCGCTGCGTGAACTGCTCGACCTGCGCACGGAACTCTCCAACCTCCGCGCCAACCTGCAGACGAAC
GAGAAGCTCGACGAAGTACTGCAGGATACCCTCGGCAACGCCGACAAGATGGCGAAGCTCAAGTCCGAAC
TCGGCCTGGAGAGCTGA