SecReT6
Protein ID: 226229277
SecReT6 ID332
T6SS typei4b
Gene symbol-
Locus tagGAU_3871
StrainGemmatimonas aurantiaca T-27
Repliconchromosome [GenBank: NC_012489] [Browse all T6SS(s) in this replicon]
Location [Strand]4563604..4565082 [+]
Producthypothetical protein
NoteTssC
UniProt IDC1AEI6
KEGG IDgau:GAU_3871
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-191, Aligned region: 66..488
Protein Sequence: 492 a.a.     [Download]
>gi|226229277|ref|YP_002763383.1| hypothetical protein GAU_3871 [Gemmatimonas aurantiaca T-27]
MADPTQAAAQSVTTDAELSLLDQIVEQGRMGKDADAKSKGKDLVKRFVSEVLEGSITINRDTETMINARI
AQIDHLLSLQLNEILHHPEFQRLESSWRGLQYLIKNSETGTMLKVKVLNVSKKDLLRDLQRAPEFDQSAL
FKKIYEEEYGVFGGTPFGAMVGDYYFDKSGQDIELLEKISNVAAAAHAPFISAASNEMFNLESWSDLDTP
RDLAKIFDSTEYARWKGFRASEDSRYVALTAPRILVREPYGASTVPVEAFNYEERVDGTNHDHYCWGNAA
FAMAANINKAFAMYGWCASIRGVEGGGLVEGLPVHNFRTESGEIAMKCPTEVQITDRREKELADLGFAPL
VHQKGTANAAFFSVQSAQKPKTYDDPKASAAARLSAQLPYIFATSRFAHYLKVMMRDKIGGYTSRAEIDV
FLNRWIQNYIALEDAGASIKARKPLSEARIDVVEVPGKPGAYRAVAFLKPHYQLDELAVSMRLVADLPQP
AK
 
Nucleotide Sequence: 1479 bp     [Download]
>ref|NC_012489.1|:4563604-4565082 hypothetical protein GAU_3871 [Gemmatimonas aurantiaca T-27]
ATGGCTGATCCGACACAAGCGGCGGCGCAATCCGTCACGACCGACGCCGAACTCTCGCTCCTCGATCAGA
TCGTCGAGCAGGGCCGCATGGGCAAAGACGCCGATGCGAAGAGCAAGGGGAAGGACCTCGTCAAGCGCTT
CGTCAGTGAAGTGCTCGAGGGCTCCATCACGATCAATCGCGACACCGAGACGATGATCAATGCGCGTATC
GCGCAGATCGATCATCTCCTCTCGCTGCAGCTCAACGAGATCCTGCATCACCCCGAGTTTCAGCGCCTGG
AGTCGTCGTGGCGCGGGCTGCAGTATCTGATCAAGAATTCCGAGACGGGCACGATGTTGAAGGTGAAGGT
GCTCAACGTCTCGAAGAAGGATCTGCTGCGTGACCTGCAGCGTGCGCCGGAATTCGATCAGAGCGCGCTG
TTCAAGAAGATCTACGAAGAAGAGTACGGCGTCTTCGGCGGCACGCCCTTCGGCGCGATGGTCGGCGACT
ACTACTTCGACAAGAGCGGCCAGGACATCGAACTGCTCGAGAAGATCTCCAACGTGGCCGCGGCCGCGCA
CGCGCCGTTCATCAGCGCGGCGTCGAACGAAATGTTCAATCTCGAAAGCTGGTCCGATCTCGACACGCCG
CGCGATCTGGCCAAGATCTTCGACAGCACCGAATACGCCCGCTGGAAAGGCTTCCGCGCCAGCGAAGATT
CGCGGTATGTGGCACTCACCGCGCCCCGCATCCTGGTGCGCGAGCCCTACGGCGCGTCCACGGTGCCCGT
CGAAGCGTTCAACTATGAAGAGCGCGTCGACGGCACGAACCACGATCACTACTGCTGGGGCAACGCCGCG
TTTGCGATGGCCGCCAACATCAACAAGGCCTTCGCGATGTACGGCTGGTGTGCGTCCATCCGTGGCGTGG
AAGGTGGTGGTCTCGTCGAAGGTCTGCCGGTGCACAACTTCCGCACCGAGTCGGGCGAAATCGCGATGAA
GTGTCCGACAGAAGTACAGATCACCGATCGCCGCGAGAAGGAGCTGGCCGACCTCGGCTTTGCCCCGCTC
GTGCACCAGAAGGGCACGGCCAACGCCGCCTTCTTCTCCGTGCAGTCGGCGCAGAAGCCCAAGACGTACG
ACGACCCGAAGGCCTCGGCCGCCGCGCGCCTCTCGGCCCAGTTGCCGTACATCTTCGCCACGTCCCGGTT
CGCGCATTACCTCAAGGTGATGATGCGCGACAAGATCGGCGGGTACACGTCCCGTGCAGAAATCGATGTG
TTCCTGAATCGCTGGATTCAGAACTACATCGCCCTCGAAGATGCCGGTGCCTCGATCAAGGCCCGCAAGC
CGCTGTCGGAAGCGCGTATCGATGTCGTGGAAGTGCCGGGCAAGCCGGGTGCCTACCGCGCGGTCGCCTT
CCTCAAGCCGCACTACCAGCTGGACGAACTCGCGGTGTCCATGCGCTTGGTGGCCGACCTGCCGCAACCG
GCCAAGTAA