SecReT6
Protein ID: 226229278
SecReT6 ID332
T6SS typei4b
Gene symbol-
Locus tagGAU_3872
StrainGemmatimonas aurantiaca T-27
Repliconchromosome [GenBank: NC_012489] [Browse all T6SS(s) in this replicon]
Location [Strand]4565149..4565640 [+]
Producthypothetical protein
NoteTssD
UniProt IDC1AEI7
KEGG IDgau:GAU_3872
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.60E-36, Aligned region: 6..139
Protein Sequence: 163 a.a.     [Download]
>gi|226229278|ref|YP_002763384.1| hypothetical protein GAU_3872 [Gemmatimonas aurantiaca T-27]
MAFDTFLKLAGIDGESTAKGFEKQMEIYSFSWGASNPTTIGSGSTGISAGKVSVSSFNVMKKTETASAKV
FAACATGKHIATAEVVLRKAGGDAGQNPFLKYKFTDVMVESIQWSGSSGGDDTPTESLSFAFGKVEIEYL
KQEKDGKLTVAGQASWDLTKVST
 
Nucleotide Sequence: 492 bp     [Download]
>ref|NC_012489.1|:4565149-4565640 hypothetical protein GAU_3872 [Gemmatimonas aurantiaca T-27]
ATGGCATTTGATACGTTCCTCAAGCTCGCGGGCATCGATGGCGAGTCGACCGCGAAGGGCTTCGAAAAGC
AGATGGAGATCTATTCCTTCAGCTGGGGCGCTTCCAACCCGACGACCATCGGCTCGGGCTCGACCGGCAT
CTCGGCAGGCAAGGTGAGCGTTTCCAGCTTCAACGTCATGAAGAAGACGGAAACCGCTTCGGCCAAGGTC
TTCGCGGCGTGCGCCACGGGCAAGCACATCGCCACGGCCGAAGTCGTGCTCCGCAAGGCGGGCGGCGACG
CCGGCCAGAATCCGTTCCTGAAGTACAAGTTCACGGACGTGATGGTCGAGAGCATCCAGTGGTCGGGTTC
GTCAGGCGGCGATGACACGCCGACCGAATCGCTCTCGTTTGCCTTCGGCAAGGTCGAGATCGAATACCTC
AAGCAGGAGAAGGACGGCAAGCTCACCGTCGCCGGTCAGGCGTCGTGGGACCTCACGAAGGTCTCCACCT
GA