SecReT6
Protein ID: 226229279
SecReT6 ID332
T6SS typei4b
Gene symbol-
Locus tagGAU_3873
StrainGemmatimonas aurantiaca T-27
Repliconchromosome [GenBank: NC_012489] [Browse all T6SS(s) in this replicon]
Location [Strand]4565655..4566356 [+]
Producthypothetical protein
NoteTagJ
UniProt IDC1AEI8
KEGG IDgau:GAU_3873
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.90E-32, Aligned region: 104..229
Protein Sequence: 233 a.a.     [Download]
>gi|226229279|ref|YP_002763385.1| hypothetical protein GAU_3873 [Gemmatimonas aurantiaca T-27]
MASAQNLYAAGQLGAAIETLGVELRSNPADAQRRTFLFELLTFSGDWSRAEKQLDVLAKNGHMAEAGTML
YRAAITAERVREHMFDSGDFPTDAAPSPVSGTLNGEPFSSIEDADPRIGARLEVMAGGRYLWIPFAHIAS
VGMEPPTRLRDLHWMSAQLRTGPSVRDLELGEVLLPALSPGVGRLSDDELRLGRAADWEELPSGDFAPIG
QKMLRVDERLVPIVDIRELLINT
 
Nucleotide Sequence: 702 bp     [Download]
>ref|NC_012489.1|:4565655-4566356 hypothetical protein GAU_3873 [Gemmatimonas aurantiaca T-27]
ATGGCCTCTGCGCAAAACCTCTACGCGGCCGGCCAGCTCGGCGCGGCAATCGAAACGCTGGGCGTCGAAC
TCCGGAGCAATCCGGCCGACGCCCAGCGGCGAACCTTTCTGTTCGAACTCCTCACCTTTTCCGGCGACTG
GAGTCGTGCGGAAAAGCAGCTCGATGTGCTGGCGAAAAACGGCCACATGGCCGAAGCCGGCACCATGCTC
TACCGCGCGGCCATCACGGCCGAGCGGGTGCGCGAACACATGTTCGACAGTGGCGACTTCCCCACCGATG
CGGCGCCGTCTCCGGTGTCCGGCACACTCAATGGGGAACCGTTTTCTTCCATCGAAGACGCCGATCCGCG
TATCGGGGCCCGTCTCGAAGTGATGGCGGGCGGTCGCTATCTCTGGATTCCCTTTGCGCACATCGCCAGC
GTCGGCATGGAACCGCCCACGCGTTTGCGCGATTTGCACTGGATGTCCGCGCAACTGCGCACGGGCCCGT
CGGTGCGCGATCTCGAACTGGGTGAAGTCCTGTTGCCAGCCCTGTCACCGGGCGTCGGACGCCTCAGTGA
CGATGAGCTGCGACTGGGACGCGCCGCCGACTGGGAAGAGCTGCCGTCGGGCGATTTCGCGCCCATCGGT
CAGAAGATGCTCCGTGTGGACGAGCGCCTGGTTCCGATCGTCGACATTCGGGAACTCCTGATCAACACCT
GA