SecReT6
Protein ID: 226229280
SecReT6 ID332
T6SS typei4b
Gene symbol-
Locus tagGAU_3874
StrainGemmatimonas aurantiaca T-27
Repliconchromosome [GenBank: NC_012489] [Browse all T6SS(s) in this replicon]
Location [Strand]4566433..4568313 [+]
Producthypothetical protein
NoteTssA
UniProt IDC1AEI9
KEGG IDgau:GAU_3874
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-22, Aligned region: 56..115
Protein Sequence: 626 a.a.     [Download]
>gi|226229280|ref|YP_002763386.1| hypothetical protein GAU_3874 [Gemmatimonas aurantiaca T-27]
MPVNSELLATLLTPIEGDNPSGRDLRYDPAYDAFKEERREEMAIPGSDDGNRKVADWNRVVTLGTDLLGK
QTKDLQVGAWMTEALLRRNGFPGLLTGLETLRGLLEQYWDTLYPEIEDDDLELRAGPLEWVGSKLNFAVQ
QVVIASGGITYLDYTQSRTIPLESAISDAPYDDQKSLRETRNEAESFGKTMPEVVDTALENTTKVFFKPL
LADIDGTLAAIAALDKQAEERFGHSAPSFVGLRNIVDELRRFAVSTLARKLEADPDPVDVMAEEGEGAVA
VDADGPQTPEPVSRQDAAQRISVVARWFRQQDPTNPAPYAMVRGFRWGELRAGAPDIDPRLLEAPATAIR
SRLKTLLLDNKWPELLEASEALMATPSGRGWLDLQRYVLTACANLGSGHDAVAATIRSELRMLLKAVPTL
PRMTLMDDTPTANDETREWLEGDALAEEPTASEADAAGETEEGADTELSDGADITADAIEDDHGTSQQGG
FARQARRARPARARDPFDIARSELAAGRPNRAIELLTVELARDPSPRGRFVRQTQIAYIMVEAGLFAVAQ
PILRKLVETIDERTLEQWESGPLVAQPIALLYRVLGHTGGDDSDRYELYLRICRLDPLQAMSLQAP
 
Nucleotide Sequence: 1881 bp     [Download]
>ref|NC_012489.1|:4566433-4568313 hypothetical protein GAU_3874 [Gemmatimonas aurantiaca T-27]
ATGCCTGTCAATTCCGAACTGCTAGCGACGCTGCTCACGCCGATCGAGGGAGACAATCCCTCGGGACGCG
ACCTGCGCTATGACCCGGCGTACGATGCGTTCAAGGAAGAGCGTCGGGAGGAGATGGCCATTCCCGGCAG
TGACGACGGCAATCGCAAGGTGGCCGACTGGAACCGCGTCGTCACCCTGGGCACCGACCTGCTGGGTAAG
CAGACCAAGGATCTGCAGGTCGGCGCATGGATGACCGAGGCCCTGCTGCGCCGCAATGGATTCCCTGGAC
TGCTGACCGGACTGGAAACGTTGCGCGGTCTGCTCGAGCAATACTGGGACACGCTGTATCCCGAGATCGA
AGACGACGACCTCGAATTGCGTGCCGGCCCCCTCGAGTGGGTGGGCAGCAAGCTGAACTTCGCCGTGCAG
CAAGTGGTGATTGCCTCGGGTGGCATCACGTACCTCGACTACACGCAGTCCCGCACCATCCCGCTCGAAA
GCGCCATCTCCGATGCGCCGTACGACGATCAGAAGTCCCTGCGGGAGACGCGCAACGAAGCAGAGTCCTT
CGGCAAGACCATGCCGGAAGTCGTGGACACTGCGCTCGAGAACACCACCAAGGTGTTCTTCAAGCCGCTG
TTGGCCGACATCGATGGCACGCTCGCCGCAATCGCCGCGCTCGACAAGCAGGCCGAAGAACGGTTCGGGC
ACAGCGCCCCCAGCTTCGTCGGACTGCGCAACATCGTCGACGAACTGCGGCGCTTTGCCGTCAGCACGTT
GGCCCGCAAGCTCGAAGCCGATCCCGATCCGGTCGATGTCATGGCCGAGGAAGGCGAAGGGGCCGTGGCG
GTCGATGCCGACGGGCCGCAAACGCCCGAACCGGTCAGCCGCCAGGACGCGGCGCAGCGTATTTCCGTGG
TCGCCCGGTGGTTCCGCCAGCAAGACCCCACCAATCCCGCGCCCTACGCCATGGTGCGCGGCTTTCGTTG
GGGAGAGCTGCGGGCCGGGGCCCCGGATATCGATCCGCGGTTGTTGGAGGCGCCCGCCACGGCCATTCGG
TCGCGGCTCAAGACCCTCCTGCTCGACAACAAGTGGCCTGAGTTGCTGGAAGCCTCGGAAGCGCTCATGG
CCACACCGTCCGGTCGCGGATGGCTCGACCTGCAGCGCTATGTGCTCACGGCCTGCGCCAATCTCGGCAG
TGGCCACGATGCGGTCGCCGCGACGATCCGCAGTGAATTGCGCATGCTCCTCAAGGCCGTACCGACGCTT
CCCCGGATGACGCTCATGGACGATACGCCGACTGCCAACGACGAAACGCGCGAGTGGCTCGAGGGCGACG
CTCTGGCCGAAGAACCAACGGCAAGCGAAGCGGATGCTGCCGGTGAGACCGAGGAAGGTGCCGATACCGA
GCTGTCCGATGGCGCCGATATCACGGCAGACGCCATTGAAGACGATCACGGCACCTCCCAGCAGGGCGGG
TTCGCCCGCCAGGCGCGTCGTGCCCGCCCCGCACGGGCGCGTGATCCCTTCGATATCGCCCGCAGTGAAC
TCGCAGCCGGACGCCCGAACCGGGCGATCGAATTGCTGACGGTCGAGCTGGCGCGCGATCCCTCGCCACG
CGGACGCTTCGTGCGGCAGACCCAGATTGCGTACATCATGGTCGAAGCGGGTCTCTTTGCCGTCGCCCAA
CCCATCCTGCGCAAGCTGGTCGAAACCATCGATGAGCGCACGCTCGAGCAGTGGGAGTCCGGCCCTCTGG
TGGCCCAGCCCATTGCGCTGCTGTATCGCGTACTGGGACACACCGGCGGCGATGACAGTGATCGCTACGA
GTTGTATCTGCGCATCTGCCGTCTCGATCCGCTGCAGGCCATGTCGCTGCAGGCGCCCTGA