SecReT6
Protein ID: 226229281
SecReT6 ID332
T6SS typei4b
Gene symbol-
Locus tagGAU_3875
StrainGemmatimonas aurantiaca T-27
Repliconchromosome [GenBank: NC_012489] [Browse all T6SS(s) in this replicon]
Location [Strand]4568340..4568831 [+]
Producthypothetical protein
NoteTssE
UniProt IDC1AEJ0
KEGG IDgau:GAU_3875
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.80E-20, Aligned region: 41..143
Protein Sequence: 163 a.a.     [Download]
>gi|226229281|ref|YP_002763387.1| hypothetical protein GAU_3875 [Gemmatimonas aurantiaca T-27]
MARTELDRNVQPSLLDRLIDESPLEGADAPKTHEESARLFRISVQRDVELLLNTRRSIVPVDMMFGEVRR
SVHEFGLPDTTGASPGTPEGRQRLTDEVRDTILRFEPRLANVTVNLSESDRVKTPQVRFMVSGTLRMDPT
PEQIMFDTVLDMSTGAFDVQDKP
 
Nucleotide Sequence: 492 bp     [Download]
>ref|NC_012489.1|:4568340-4568831 hypothetical protein GAU_3875 [Gemmatimonas aurantiaca T-27]
ATGGCTCGCACAGAACTCGATCGCAACGTACAGCCCTCGCTGCTCGACCGTCTCATCGACGAGTCGCCGC
TCGAGGGCGCTGACGCGCCCAAAACGCACGAAGAATCCGCGCGGCTGTTCCGCATCTCGGTGCAGCGCGA
CGTGGAGTTGCTGCTGAACACCCGACGGTCGATCGTGCCCGTCGACATGATGTTTGGCGAAGTCCGACGT
TCCGTGCACGAATTTGGCCTGCCCGACACCACCGGGGCATCGCCTGGCACCCCCGAAGGACGCCAACGCC
TGACCGATGAAGTCCGTGACACCATCCTGCGCTTCGAACCCCGTCTCGCCAACGTCACGGTGAACCTGAG
CGAGAGCGATCGCGTCAAGACGCCACAAGTCCGTTTCATGGTGTCCGGCACATTGCGCATGGACCCCACC
CCCGAGCAGATCATGTTCGACACCGTGCTCGACATGTCGACCGGTGCGTTTGACGTACAGGACAAGCCGT
AG