SecReT6
Protein ID: 226229282
SecReT6 ID332
T6SS typei4b
Gene symbol-
Locus tagGAU_3876
StrainGemmatimonas aurantiaca T-27
Repliconchromosome [GenBank: NC_012489] [Browse all T6SS(s) in this replicon]
Location [Strand]4568906..4570759 [+]
Producthypothetical protein
NoteTssF
UniProt IDC1AEJ1
KEGG IDgau:GAU_3876
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-199, Aligned region: 5..617
Protein Sequence: 617 a.a.     [Download]
>gi|226229282|ref|YP_002763388.1| hypothetical protein GAU_3876 [Gemmatimonas aurantiaca T-27]
MQDDLLLYYERELTYLRKLGAEFAQQYPKVAARLQLEANRCEDPHVERLLEGFAFLTARIHRRLDDDFPE
ISESLLEVLHPQIIRPLPSMAIVEIALDPAQGRTPEGFHVPRHSVLHTKPVNGVPCIFRTNYDTTLYPLR
IAGAEWTTPDRAGAGAHGREAVAAVRLSLQAFNGVTLEALTMDALRVHLAADGSVADTLYELLANNCVQV
VVRNPDRPNAAPVLLGSRAVQPVGFGPDETMLPQSNRSFAGYSLLQELFAFPEKFHFLDIVGVGAALKQL
GATDRAEIGLLISSFERTERRQALELSISARTFRLGCTPAVNLFSQSAEPILLTERSYEHLVIPDARRRL
EVEVWSVDNVQLIEHAARTTRQVSPLYSHSHNLGAEGIDSGDLFWQSMRRTSGWRTDRGTDVHLSFSDLS
GQLRLPDQDVASVHVTCSNGDMPSRLPFGTDERGDFELVSGGPIQRISAIVNPTRAIQPKLGKSLLWRLI
SSLSLNHLSLTDEGGDALRELLRLHNVTNSLSSERQIDGLIGVRTEPAFARVTAAHGMTFARGRRIDLDF
DEDLFPGGGMFLMASVLERFFALYASMNSFTRVGVRSKQRRRQVVDWAPRAGWRTLL
 
Nucleotide Sequence: 1854 bp     [Download]
>ref|NC_012489.1|:4568906-4570759 hypothetical protein GAU_3876 [Gemmatimonas aurantiaca T-27]
ATGCAAGACGATCTGCTGCTGTATTACGAGCGCGAACTCACGTACCTCCGCAAGCTCGGCGCGGAGTTCG
CACAGCAATACCCGAAAGTCGCGGCGCGCCTGCAGCTCGAGGCCAACCGCTGCGAAGATCCGCATGTCGA
GCGTCTGCTCGAAGGATTCGCGTTCCTCACGGCGCGCATTCACCGACGGCTCGACGACGATTTCCCCGAG
ATCAGCGAATCGCTGCTCGAGGTGCTGCACCCGCAGATCATCCGGCCACTGCCGTCGATGGCCATCGTGG
AGATCGCACTGGATCCGGCGCAGGGACGTACGCCCGAAGGTTTCCACGTGCCACGCCACAGCGTGTTGCA
CACGAAACCCGTCAACGGCGTGCCGTGCATCTTTCGCACGAACTACGACACCACGCTGTACCCGCTGCGC
ATCGCGGGTGCGGAGTGGACCACGCCCGATCGGGCTGGTGCCGGCGCGCATGGGCGTGAGGCGGTGGCGG
CGGTGCGCCTCAGCCTGCAGGCCTTCAACGGCGTGACGCTCGAAGCGCTCACGATGGATGCCCTGCGCGT
GCATCTCGCCGCCGATGGCAGTGTCGCCGACACGTTGTACGAACTGCTCGCCAACAACTGCGTGCAGGTG
GTGGTGCGCAATCCGGATCGGCCGAACGCCGCTCCCGTCTTGCTCGGGTCACGGGCCGTACAACCGGTGG
GATTTGGTCCCGACGAGACCATGTTGCCGCAGTCCAATCGCAGCTTTGCGGGCTATTCGCTGCTGCAGGA
ACTGTTTGCGTTCCCCGAGAAGTTCCACTTCCTCGACATCGTCGGTGTGGGCGCGGCGCTGAAGCAGCTC
GGAGCCACCGATCGCGCCGAAATCGGGCTGCTCATCAGCAGCTTCGAGCGCACCGAACGGCGACAGGCGC
TCGAACTCAGTATCTCCGCGCGCACCTTCCGCCTCGGATGCACGCCGGCGGTCAATCTGTTTTCGCAGTC
GGCCGAACCGATTCTGCTCACCGAACGCAGCTACGAGCATCTGGTCATTCCCGATGCTCGCCGCCGCCTC
GAGGTGGAAGTGTGGTCGGTGGACAACGTGCAGCTCATCGAACACGCCGCCCGCACGACGCGGCAGGTCT
CGCCGCTGTACTCGCATTCGCACAACCTCGGCGCGGAAGGCATCGACAGCGGCGATCTGTTCTGGCAGAG
CATGCGCCGCACCTCGGGGTGGCGCACCGACCGCGGCACGGACGTGCATCTCAGCTTCTCCGACCTCTCG
GGACAGTTGCGTCTGCCCGATCAGGACGTGGCCTCGGTGCATGTCACCTGTTCGAACGGCGACATGCCCA
GCCGGTTGCCCTTCGGCACCGACGAACGGGGCGACTTCGAGCTGGTGAGCGGTGGGCCGATTCAGCGCAT
TTCGGCCATCGTGAATCCGACGCGCGCCATCCAACCCAAGTTGGGCAAATCGCTGTTGTGGCGCCTCATC
TCGTCACTGTCGCTCAATCATCTCTCGCTGACGGATGAAGGCGGTGATGCGCTGCGTGAGCTGCTGCGCC
TGCACAACGTGACCAACAGCCTGAGTTCGGAACGCCAGATCGATGGTCTCATCGGCGTGCGCACCGAACC
AGCCTTCGCGCGCGTCACCGCCGCACATGGCATGACCTTCGCCCGTGGACGACGCATCGACCTGGACTTC
GATGAAGATCTGTTCCCGGGCGGTGGCATGTTTCTCATGGCCAGCGTGCTGGAACGGTTCTTCGCCCTCT
ATGCGTCGATGAACAGCTTCACCCGGGTCGGCGTGCGATCGAAGCAACGTCGTCGTCAGGTGGTGGACTG
GGCCCCCCGCGCCGGCTGGCGGACATTGTTGTGA