SecReT6
Protein ID: 226229283
SecReT6 ID332
T6SS typei4b
Gene symbol-
Locus tagGAU_3877
StrainGemmatimonas aurantiaca T-27
Repliconchromosome [GenBank: NC_012489] [Browse all T6SS(s) in this replicon]
Location [Strand]4570756..4571892 [+]
Producthypothetical protein
NoteTssG
UniProt IDC1AEJ2
KEGG IDgau:GAU_3877
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.90E-95, Aligned region: 53..362
Protein Sequence: 378 a.a.     [Download]
>gi|226229283|ref|YP_002763389.1| hypothetical protein GAU_3877 [Gemmatimonas aurantiaca T-27]
MTETPDVPQAEGLADPFATDESERSSGFTTTFLETPARAEARRRLEGVLEREGTGFEFFQLMRLLQRMHP
DRDPVGGWSDPRGEVARMHVIPTLAFPPSEISGVEITSSGPRRKRRDNEPARVGVRFFGLVGPQGVLPQG
YTEYAAGRARARDTGLRDFLDLFHHRLLSLFYRAWERHHTSVALERGDEDRIHAHLLDLVGAGNAIGQRK
SVLPPDTMAYYAGLLALRSRPALGLAQLVSDYFGVTATVEQFVGEWRMLPDGGQVCLGDDDADGRLGQAV
IGSAVYDPHSRVVLRLGPLSRAQFDTFLPQGRHHKVLKSLAQFYADDEVGVDAQLVLARDEVPSASLGTS
TSPRLGFGTWLRNRTPTRDPDDVLLRLS
 
Nucleotide Sequence: 1137 bp     [Download]
>ref|NC_012489.1|:4570756-4571892 hypothetical protein GAU_3877 [Gemmatimonas aurantiaca T-27]
GTGACCGAGACGCCGGACGTGCCGCAGGCCGAAGGACTGGCCGATCCGTTCGCCACGGATGAATCGGAAA
GATCGTCGGGCTTCACGACGACCTTTCTCGAAACACCCGCGCGGGCGGAGGCGCGTCGTCGACTCGAAGG
TGTTCTCGAACGCGAAGGGACCGGGTTCGAGTTCTTTCAGTTGATGCGGTTGTTGCAGCGCATGCACCCG
GACCGCGACCCGGTGGGCGGGTGGTCCGATCCGCGCGGTGAAGTCGCCCGCATGCACGTGATCCCCACGC
TCGCGTTTCCGCCGAGTGAAATCTCGGGAGTGGAGATCACGTCATCCGGTCCGCGGCGTAAACGCCGTGA
CAATGAACCGGCTCGGGTGGGCGTACGGTTTTTCGGTCTCGTCGGGCCACAGGGCGTCCTGCCGCAAGGA
TACACAGAGTATGCCGCCGGTCGGGCGCGTGCCCGCGACACCGGACTGCGGGACTTCCTCGACCTGTTCC
ACCATCGGCTGCTGTCGCTGTTCTACCGTGCCTGGGAACGCCACCACACGTCGGTGGCCCTGGAACGGGG
TGACGAAGACCGCATCCATGCGCATCTGCTCGATCTCGTCGGTGCCGGCAATGCGATCGGTCAGCGCAAG
AGTGTGCTGCCCCCCGACACGATGGCGTACTACGCCGGGCTGCTGGCACTGCGCTCGCGACCGGCCCTCG
GGCTCGCACAATTGGTGTCGGACTACTTCGGTGTCACCGCCACGGTGGAACAGTTCGTGGGCGAATGGCG
CATGTTGCCCGACGGCGGCCAGGTGTGCCTCGGCGATGACGACGCCGATGGTCGACTGGGCCAGGCCGTG
ATCGGCAGTGCGGTCTATGATCCACATTCACGCGTAGTGCTGCGCCTCGGGCCGCTGTCCCGCGCACAGT
TCGACACGTTTCTTCCCCAGGGACGTCATCACAAGGTGCTCAAGTCCCTGGCGCAGTTTTACGCCGATGA
CGAGGTGGGCGTCGACGCGCAGCTAGTGCTCGCGCGCGATGAAGTCCCCTCGGCCTCCCTGGGTACCTCC
ACCTCCCCGCGACTGGGGTTCGGCACGTGGCTGCGCAATCGCACGCCCACGCGCGATCCGGACGACGTGC
TGCTGCGCCTCTCCTGA