SecReT6
Protein ID: 226229284
SecReT6 ID332
T6SS typei4b
Gene symbolclpB
Locus tagGAU_3878
StrainGemmatimonas aurantiaca T-27
Repliconchromosome [GenBank: NC_012489] [Browse all T6SS(s) in this replicon]
Location [Strand]4571986..4574649 [+]
Productputative chaperone ClpB
NoteTssH
UniProt IDC1AEJ3
KEGG IDgau:GAU_3878
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.40E-41, Aligned region: 234..252
AAA_2 [PF07724], Evalue: 1.40E-41, Aligned region: 617..784
AAA [PF00004], Evalue: 2.40E-19, Aligned region: 234..364
AAA [PF00004], Evalue: 2.40E-19, Aligned region: 623..745
AAA_5 [PF07728], Evalue: 6.80E-15, Aligned region: 234..254
AAA_5 [PF07728], Evalue: 6.80E-15, Aligned region: 622..740
ClpB_D2-small [PF10431], Evalue: 3.00E-14, Aligned region: 792..863
AAA_16 [PF13191], Evalue: 9.40E-10, Aligned region: 28..72
AAA_16 [PF13191], Evalue: 9.40E-10, Aligned region: 211..255
AAA_16 [PF13191], Evalue: 9.40E-10, Aligned region: 278..312
AAA_16 [PF13191], Evalue: 9.40E-10, Aligned region: 481..540
AAA_16 [PF13191], Evalue: 9.40E-10, Aligned region: 618..645
AAA_16 [PF13191], Evalue: 9.40E-10, Aligned region: 687..711
AAA_22 [PF13401], Evalue: 5.60E-08, Aligned region: 63..129
AAA_22 [PF13401], Evalue: 5.60E-08, Aligned region: 234..315
AAA_22 [PF13401], Evalue: 5.60E-08, Aligned region: 619..643
AAA_22 [PF13401], Evalue: 5.60E-08, Aligned region: 683..716
Sigma54_activat [PF00158], Evalue: 3.50E-06, Aligned region: 230..254
Sigma54_activat [PF00158], Evalue: 3.50E-06, Aligned region: 621..741
Clp_N [PF02861], Evalue: 7.40E-06, Aligned region: 25..74
Clp_N [PF02861], Evalue: 7.40E-06, Aligned region: 114..129
Zeta_toxin [PF06414], Evalue: 1.10E-05, Aligned region: 229..254
Zeta_toxin [PF06414], Evalue: 1.10E-05, Aligned region: 612..662
AAA_14 [PF13173], Evalue: 2.50E-05, Aligned region: 234..336
AAA_14 [PF13173], Evalue: 2.50E-05, Aligned region: 620..703
AAA_17 [PF13207], Evalue: 3.80E-05, Aligned region: 234..285
AAA_17 [PF13207], Evalue: 3.80E-05, Aligned region: 622..658
AAA_19 [PF13245], Evalue: 0.00014, Aligned region: 231..256
AAA_19 [PF13245], Evalue: 0.00014, Aligned region: 618..641
IstB_IS21 [PF01695], Evalue: 0.00024, Aligned region: 228..255
IstB_IS21 [PF01695], Evalue: 0.00024, Aligned region: 622..640
AAA_25 [PF13481], Evalue: 0.001, Aligned region: 230..305
AAA_25 [PF13481], Evalue: 0.001, Aligned region: 617..640
AAA_18 [PF13238], Evalue: 0.0011, Aligned region: 234..257
AAA_18 [PF13238], Evalue: 0.0011, Aligned region: 624..656
AAA_29 [PF13555], Evalue: 0.0026, Aligned region: 227..249
AAA_29 [PF13555], Evalue: 0.0026, Aligned region: 618..647
Arch_ATPase [PF01637], Evalue: 0.0053, Aligned region: 213..254
Arch_ATPase [PF01637], Evalue: 0.0053, Aligned region: 287..317
Arch_ATPase [PF01637], Evalue: 0.0053, Aligned region: 618..635
Arch_ATPase [PF01637], Evalue: 0.0053, Aligned region: 693..716
SRP54 [PF00448], Evalue: 0.0083, Aligned region: 234..254
SRP54 [PF00448], Evalue: 0.0083, Aligned region: 621..653
RNA_helicase [PF00910], Evalue: 0.0094, Aligned region: 235..255
RNA_helicase [PF00910], Evalue: 0.0094, Aligned region: 623..644
RNA_helicase [PF00910], Evalue: 0.0094, Aligned region: 720..740
Protein Sequence: 887 a.a.     [Download]
>gi|226229284|ref|YP_002763390.1| putative chaperone ClpB [Gemmatimonas aurantiaca T-27]
MSVNLRGLIAKLNAPTRSAVEAAAGLCLSRTNYDVEIEHLFVKLLDSSDSDLAAILKHFGVNRSRLADDI
ARALDKLKTGNARTPSISPSVVNVLREAWVLGSVEYGAPRVRSGHVMLALLSVPELQRLSAEFTKEFEKI
PADVLKKDFVTITASSAEATAEIGSIDSVAAGASASSSGGGTAKAGGRTPNLDSYTVDLTANAKSGKIDQ
VLGRDFEVRQVVDILTRRRQNNPILVGEAGVGKTAVVEGFARRIVDGDVPPPLRNVRLLSLDLAMLQAGA
GVKGEFENRLKGLIEEVKNSPTPIILFIDEAHTMIGAGGAAGQNDAANLLKPALARGELRTIAATTWSEY
KKFFEKDPALSRRFQLVKVEEPTEDVCCIMMRAVVPSLEKHHTVHILDSGMEAAVRLSHRYLADRQLPDK
AVSVLDTACARLALGQSATPGPVEDCKRILDDLALQDRVLNREQTAGADHRERLAGIAERRTQVEAQLAE
LEGRWLKEKDTVSKILEVRGKLVAESANADQTAADALRAEYTQAMSELEALQGENPLVRPFVDASIVGEV
ISGWTGIPVGKMMSDELGTMLELEKHLGARVIGQDHALVDISRRVRTSKAGIEDPNKPKGVFMLVGPSGV
GKTETALALSDMLFGGERNIVTINMSEFQEAHTVSTLKGSPPGYVGYGEGGVLTEAVRRRPYSVVLLDEV
EKAHPDVLELFFQVFDKGVMEDGEGRQIDFKNTIIILTTNAGTDTIMKLTADPETLPFPDAMAKALKPEL
DAVFKPAFLGRMVIVPFYPVRDENLKQIVRLKIGKISRRLRETHKLTLQHDETLISQVAARCTEVESGAR
NVDNILSNTLLPEISRLLLASMAEGTRPSALKVGVAEDGDFTYEAVV
 
Nucleotide Sequence: 2664 bp     [Download]
>ref|NC_012489.1|:4571986-4574649 putative chaperone ClpB [Gemmatimonas aurantiaca T-27]
ATGTCGGTGAATCTTCGTGGCTTGATTGCCAAGCTCAACGCGCCCACCCGCAGCGCCGTCGAAGCGGCCG
CTGGCTTGTGCCTGTCGCGCACCAATTACGACGTCGAAATCGAGCATCTGTTCGTCAAGCTGCTCGATTC
CTCCGACAGTGACCTGGCCGCCATTCTCAAGCACTTCGGCGTCAATCGTTCGCGCCTGGCCGATGACATC
GCGCGTGCACTCGACAAGCTCAAGACCGGCAACGCCCGCACGCCGTCCATCAGCCCGTCGGTGGTGAACG
TGCTGCGTGAAGCCTGGGTGCTCGGTTCGGTCGAGTACGGCGCGCCGCGTGTGCGTTCGGGCCATGTGAT
GCTCGCCCTGCTGTCGGTGCCGGAACTGCAGCGCCTCTCGGCGGAGTTCACGAAAGAATTCGAGAAGATC
CCGGCCGATGTGCTCAAGAAAGACTTCGTGACCATCACGGCGTCTTCGGCCGAAGCGACGGCCGAAATCG
GCAGCATCGATTCGGTGGCCGCGGGTGCAAGCGCCTCGAGCAGCGGCGGTGGTACCGCCAAGGCCGGTGG
CCGCACGCCGAACCTCGATTCGTACACGGTCGACCTCACGGCCAATGCCAAGAGCGGCAAGATCGATCAG
GTCCTCGGCCGCGACTTCGAAGTCCGTCAGGTGGTCGACATCCTCACGCGTCGTCGTCAGAACAACCCCA
TCCTCGTAGGTGAGGCTGGTGTCGGCAAGACGGCCGTCGTGGAAGGTTTTGCGCGCCGCATCGTGGACGG
AGACGTGCCGCCTCCGCTGCGCAACGTGCGTCTGCTCTCGCTCGACCTGGCCATGCTGCAGGCCGGCGCG
GGTGTGAAAGGTGAGTTCGAAAACCGCCTCAAGGGTCTGATCGAGGAAGTGAAGAACTCCCCCACCCCGA
TCATTCTGTTCATCGACGAAGCCCACACGATGATCGGCGCGGGTGGTGCGGCCGGCCAGAACGACGCGGC
CAACCTGCTCAAGCCGGCGCTCGCGCGCGGTGAGCTGCGCACCATCGCCGCCACCACGTGGAGCGAGTAC
AAGAAGTTCTTCGAGAAGGACCCGGCGCTTTCGCGTCGCTTCCAGCTCGTGAAGGTCGAAGAGCCCACCG
AAGACGTGTGCTGCATCATGATGCGCGCCGTCGTGCCCTCGCTCGAGAAGCACCACACGGTGCACATCCT
CGACAGCGGCATGGAAGCGGCCGTGCGCCTGTCGCACCGCTACCTCGCCGACCGTCAGTTGCCCGACAAG
GCCGTCAGCGTGCTCGACACCGCCTGCGCGCGTCTCGCGCTGGGTCAGAGCGCCACGCCCGGCCCGGTCG
AAGACTGCAAGCGCATCCTCGACGATCTCGCACTGCAGGATCGTGTGCTGAATCGTGAACAGACCGCCGG
CGCCGATCACCGTGAACGTCTGGCCGGCATCGCCGAACGACGCACGCAGGTGGAAGCGCAGTTGGCCGAA
CTCGAAGGACGTTGGCTCAAGGAAAAGGACACGGTGTCCAAGATCCTCGAGGTGCGTGGCAAGCTCGTCG
CCGAATCAGCCAATGCGGATCAGACGGCCGCGGACGCCCTGCGCGCAGAATACACGCAGGCCATGAGCGA
ACTCGAGGCACTGCAGGGTGAGAACCCGCTGGTGCGTCCGTTCGTCGATGCGTCCATCGTCGGTGAAGTG
ATCTCCGGCTGGACCGGCATCCCGGTCGGCAAGATGATGAGCGACGAACTGGGCACGATGCTCGAGCTCG
AGAAGCACCTCGGCGCGCGTGTCATCGGTCAGGATCATGCGCTGGTGGATATCTCGCGTCGCGTGCGCAC
GTCGAAGGCCGGCATCGAAGATCCGAACAAGCCGAAGGGCGTGTTCATGCTCGTCGGCCCGTCCGGCGTC
GGCAAGACGGAAACCGCACTGGCCCTGTCCGACATGCTGTTCGGTGGTGAACGCAACATCGTCACCATCA
ACATGTCGGAGTTCCAGGAAGCCCACACCGTGTCCACGCTCAAGGGTTCGCCCCCGGGGTACGTGGGCTA
CGGCGAAGGTGGTGTGCTCACGGAAGCCGTGCGTCGTCGTCCGTACAGTGTCGTGCTGCTCGACGAAGTG
GAGAAGGCACACCCCGATGTGCTCGAACTCTTCTTCCAGGTGTTCGACAAGGGCGTGATGGAAGACGGCG
AAGGCCGTCAGATCGATTTCAAGAACACGATCATCATCCTGACCACGAACGCCGGCACCGATACGATCAT
GAAGCTGACGGCCGATCCGGAAACGCTGCCGTTCCCGGATGCGATGGCCAAGGCCCTCAAGCCGGAACTC
GACGCGGTGTTCAAGCCGGCGTTCCTGGGCCGCATGGTCATCGTGCCGTTCTACCCGGTGCGCGACGAGA
ACCTCAAGCAGATCGTCCGCCTCAAGATCGGCAAGATCTCGCGCCGTCTGCGCGAAACGCACAAGCTCAC
CCTGCAGCACGACGAAACGCTCATCAGCCAAGTGGCGGCGCGTTGCACGGAAGTGGAGAGCGGTGCCCGT
AACGTCGACAACATTCTCAGCAACACGCTGCTGCCGGAAATCTCCCGTCTGCTGCTGGCCTCGATGGCGG
AAGGCACCCGTCCGAGCGCGCTCAAGGTGGGCGTGGCCGAAGACGGCGACTTCACGTACGAAGCGGTGGT
GTGA