SecReT6
Protein ID: 226229285
SecReT6 ID332
T6SS typei4b
Gene symbol-
Locus tagGAU_3879
StrainGemmatimonas aurantiaca T-27
Repliconchromosome [GenBank: NC_012489] [Browse all T6SS(s) in this replicon]
Location [Strand]4574754..4576958 [+]
Producthypothetical protein
NoteTssI
UniProt IDC1AEJ4
KEGG IDgau:GAU_3879
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-47, Aligned region: 29..352
Phage_base_V [PF04717], Evalue: 1.30E-22, Aligned region: 381..394
Phage_base_V [PF04717], Evalue: 1.30E-22, Aligned region: 401..482
Phage_base_V [PF04717], Evalue: 1.30E-22, Aligned region: 561..571
Gp5_C [PF06715], Evalue: 2.50E-08, Aligned region: 534..556
Gp5_C [PF06715], Evalue: 2.50E-08, Aligned region: 572..591
Gp5_C [PF06715], Evalue: 2.50E-08, Aligned region: 596..614
Gp5_C [PF06715], Evalue: 2.50E-08, Aligned region: 616..639
Gp5_C [PF06715], Evalue: 2.50E-08, Aligned region: 641..651
Gp5_C [PF06715], Evalue: 2.50E-08, Aligned region: 717..728
Protein Sequence: 734 a.a.     [Download]
>gi|226229285|ref|YP_002763391.1| hypothetical protein GAU_3879 [Gemmatimonas aurantiaca T-27]
MAWSQANRPFRLKTPLGEDVLLLVSWRGEEAVSSLFHFTVVAASERNDIKPKELLLKGVTLELELGGGKK
RTICGVVRRFARGGEYAEGHSTYLLEIVPPHWALTLDSGFDIFQNKTARDVCDKLLTGTPHEWKMVRTLD
PRPYCFRYRESRWACTSRLLEQEGVWYRFDHKSGEAKLVMGDNSSSATGAWGLDTLKYDPNMAGSHNSFT
EPAVFDLNTEAVPHLAKSKVRSATEFLATNNLSEEITGKADVYSAPSDLAWYDFDQQMGSQHSGFNHSGG
ETASDVAKFQPDTKVYARLAQERSESEAVVYRGQSRYVGLESGSKTTISGRHFEGFDGSLFITRVEHHGN
NGPYSTDGEPASYRNSFEGIPAATPYRPQRTTPWPRVAGSHAGTVVGPAGEEIFTDPHGRVQVVFKWDLD
NSTKLERSCWVRVAQPFAGQGFGAVFLPRIGHEVIVDFLDGNPDNPVIVGSLYNGANLPPWKLPENKTQS
GVRTQSTLNGGSDNYNELQFEDKKGSELINVQAEKDLKTLVKNDETRTVNHDRTTTIKNNETKTVKEGYE
HTTIEKGEQVITVKDNNRTLHVEKDHTITVNGNEAFTVKGNRDGTVKGNQAHAISGNDEMTVKGKQTTTI
TGNEAITIEQGNQSLQVKMGNIATKADLGNIETKASLGKITLEAMQMIELKVGANSIQISQAGVTIKGIM
VKIEGTAMAQVKAPMTQVNGDGMVMIKGGITMIN
 
Nucleotide Sequence: 2205 bp     [Download]
>ref|NC_012489.1|:4574754-4576958 hypothetical protein GAU_3879 [Gemmatimonas aurantiaca T-27]
ATGGCATGGTCACAGGCCAATCGGCCGTTCCGACTCAAGACGCCACTGGGAGAGGATGTGTTGCTCCTGG
TGTCGTGGCGGGGCGAAGAGGCGGTCTCTTCGCTCTTCCACTTCACCGTGGTGGCCGCGAGCGAACGCAA
CGACATCAAGCCCAAGGAGCTGCTGCTCAAGGGTGTCACGCTGGAGCTCGAACTCGGCGGCGGCAAGAAG
CGCACGATCTGCGGTGTCGTACGTCGGTTCGCACGCGGTGGAGAGTACGCGGAAGGACATTCGACCTATC
TGCTGGAGATCGTGCCCCCGCACTGGGCCCTCACGCTCGACAGCGGGTTCGACATCTTCCAGAACAAGAC
GGCGCGTGATGTGTGTGACAAGCTGCTCACGGGTACGCCCCATGAGTGGAAGATGGTGCGCACCCTCGAT
CCGCGTCCCTATTGTTTCCGCTACCGCGAGAGCCGCTGGGCCTGCACGTCACGACTGCTGGAACAGGAAG
GCGTCTGGTATCGCTTCGACCACAAGTCGGGCGAAGCCAAGCTGGTGATGGGCGACAACTCCTCCTCGGC
CACGGGCGCGTGGGGACTGGATACGCTCAAGTACGACCCGAACATGGCGGGTTCGCACAACTCGTTCACC
GAGCCGGCCGTCTTCGATCTCAACACCGAAGCCGTCCCCCATCTCGCCAAGTCGAAAGTGCGTTCGGCCA
CCGAGTTTTTGGCCACCAACAATCTTTCCGAAGAAATCACCGGCAAGGCGGACGTCTACTCGGCGCCGTC
CGATCTGGCCTGGTACGATTTTGATCAGCAGATGGGATCGCAGCACAGCGGCTTCAACCACAGTGGCGGA
GAAACCGCGAGCGATGTCGCGAAGTTTCAGCCCGACACGAAGGTCTATGCGCGCCTGGCGCAGGAACGCT
CGGAGTCCGAAGCGGTCGTGTATCGCGGACAGTCGCGATATGTCGGCCTGGAGTCCGGATCCAAGACCAC
CATCAGCGGCCGCCACTTCGAAGGATTCGACGGCAGTCTCTTCATCACCCGCGTCGAACATCACGGCAAC
AACGGACCGTACAGCACGGATGGGGAGCCGGCCAGCTACCGGAATTCGTTCGAGGGTATCCCGGCCGCCA
CGCCGTACCGTCCGCAGCGCACCACGCCATGGCCGCGCGTGGCGGGATCGCACGCGGGTACGGTGGTGGG
TCCTGCCGGTGAAGAGATCTTCACGGATCCCCATGGACGGGTGCAGGTGGTCTTCAAGTGGGATCTCGAC
AACTCCACGAAACTGGAGCGCTCCTGCTGGGTGCGCGTGGCGCAGCCCTTTGCCGGTCAGGGATTTGGCG
CGGTGTTCCTGCCGCGCATCGGACACGAGGTGATTGTCGATTTTCTCGACGGCAATCCCGACAATCCGGT
GATTGTGGGCAGTCTCTACAACGGCGCGAATCTGCCGCCGTGGAAATTGCCCGAAAACAAAACGCAGAGC
GGTGTGCGCACCCAGAGCACGCTCAATGGCGGCTCCGACAACTACAACGAACTGCAGTTCGAGGACAAGA
AGGGCTCGGAACTGATCAACGTGCAGGCGGAGAAGGACCTGAAGACGCTCGTCAAGAACGACGAGACGCG
CACGGTCAATCACGACCGCACCACCACGATCAAGAACAACGAGACCAAGACGGTCAAAGAAGGTTACGAA
CACACGACCATCGAGAAGGGCGAGCAGGTCATCACCGTCAAGGACAACAACCGGACCCTGCACGTCGAGA
AGGACCACACCATCACGGTGAACGGCAATGAAGCGTTCACGGTGAAGGGCAACCGCGACGGGACGGTGAA
GGGCAACCAGGCCCACGCGATCTCGGGTAACGACGAAATGACGGTGAAGGGTAAGCAGACCACCACGATC
ACCGGCAACGAAGCGATCACCATCGAGCAGGGCAATCAGTCCCTGCAGGTCAAGATGGGCAACATCGCCA
CCAAGGCCGATCTCGGGAACATCGAGACCAAGGCATCGCTCGGAAAGATCACACTCGAAGCGATGCAGAT
GATCGAACTCAAGGTCGGGGCCAACTCCATCCAGATCAGTCAGGCCGGCGTCACCATCAAGGGCATCATG
GTGAAGATCGAAGGCACGGCCATGGCGCAGGTGAAGGCCCCGATGACGCAGGTCAACGGTGATGGCATGG
TGATGATCAAGGGCGGCATCACCATGATCAATTGA