SecReT6
Protein ID: 226944738
SecReT6 ID333
T6SS typei3
Gene symbol-
Locus tagAvin_26600
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]2722432..2724495 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDC1DJR7
KEGG IDavn:Avin_26600
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.80E-81, Aligned region: 24..328
Phage_GPD [PF05954], Evalue: 4.80E-81, Aligned region: 617..672
Phage_base_V [PF04717], Evalue: 1.20E-24, Aligned region: 366..458
Protein Sequence: 687 a.a.     [Download]
>gi|226944738|ref|YP_002799811.1| unnamed protein product [Azotobacter vinelandii DJ]
MDRNVKVHSVLGEDVLLFRAMTGTETLSQLFRFEVELLAESHSLSLKTLLGSALTLEIATRDEGVRYLNG
LVTRCELFGREDRTARLYRYRATVRPWLWLLSRNRDCRIFQEQSVPEIVQAIFAKYSSLTVELSLTGTYR
QWGYCVQYQESDFSFVSRLLEHEGIYYYFRHELGSHTLVLVDDIETHETFAGYESIPFFAADRLVAVQEE
CIDIYRVSEEMASGSYIGDDYNFTAPKSLMRALLSNPAEHEHSDAEVYEWLTGYRDYGEAAHYTRIRLEE
LQTRRELDEGHAIARGLAPGYRFTLRNCPREEANRDYLVVSVTYHLKEPGYASNPEPARYDFDFVTQPVS
LPFRPRRITPKPRPHGPQTAVVVGPEGEEIWTDEYGRVKVQFHWDRYGQMNEESSCWIRVASSWAGSTFG
GIYIPRIGQEVIVDFIGGEIDRPIVIGSTYNADQMPPFELPLNSSQSGIVTRTLEGTPVNGNFFYFEDRA
GEELVRIKAERDHDTEVLNDTNHFTVKTHSLTVGDLEIAVGDDGGGATSNTINQPLSVAGGGNFNVRTVN
ITIRSAVNIDISAIKVGVAGVNTSLDGVKVAIVGVNTVYNGATFIRNETIKKEHNFYKSESTHLEHKESH
AVEEKGTLRRIRYNLVNFSSGTFRADYQKKKDDAKQKARDELKKKIGSPQLPPGTAI
 
Nucleotide Sequence: 2064 bp     [Download]
>gi|226942170|ref|NC_012560.1|:c2724495-2722432 Azotobacter vinelandii DJ chromosome, complete genome
ATGGATCGTAACGTCAAGGTACACAGCGTGTTGGGCGAGGACGTGCTGCTGTTTCGCGCCATGACCGGCA
CGGAAACGCTGTCGCAGCTCTTCCGGTTCGAAGTCGAACTGCTCGCGGAAAGCCATTCGCTGTCGCTGAA
AACGCTGCTGGGCAGCGCGCTGACCCTGGAAATCGCCACCCGGGACGAGGGGGTGCGCTACCTCAACGGC
CTGGTCACCCGCTGCGAGCTGTTCGGCCGCGAGGACCGCACCGCGCGGCTGTACCGCTACCGCGCCACCG
TCCGCCCCTGGCTGTGGCTGCTCAGCCGCAACCGCGACTGCCGGATCTTCCAGGAGCAGAGCGTCCCGGA
GATCGTGCAGGCGATCTTCGCCAAGTACAGCAGTCTGACCGTCGAACTGTCGCTCACCGGCACCTACCGC
CAGTGGGGCTACTGCGTGCAGTACCAGGAAAGCGACTTCAGCTTCGTTTCCCGGCTGCTGGAGCACGAGG
GCATCTACTACTACTTCCGGCACGAACTGGGCAGCCACACCCTGGTGCTGGTGGACGACATCGAGACGCA
CGAAACCTTCGCCGGTTACGAGAGCATTCCCTTCTTCGCCGCCGACCGCCTGGTGGCGGTGCAGGAGGAG
TGCATCGACATCTACCGGGTCAGCGAAGAGATGGCGTCGGGCAGCTATATCGGCGACGACTACAACTTCA
CCGCGCCGAAGAGCCTGATGCGCGCCCTGCTCAGCAATCCGGCGGAACACGAACACAGCGACGCCGAAGT
CTACGAATGGCTGACCGGCTACCGGGACTACGGCGAGGCGGCCCACTACACGCGCATCCGCCTGGAGGAA
CTGCAGACCCGCCGCGAACTCGACGAAGGCCACGCCATCGCGCGCGGCCTGGCGCCGGGCTACCGCTTCA
CCCTGCGCAACTGCCCGCGGGAAGAAGCCAACCGCGACTACCTGGTGGTGAGCGTCACCTACCACCTCAA
GGAGCCGGGCTACGCCAGCAACCCCGAACCGGCCCGCTACGACTTCGACTTCGTCACCCAGCCGGTCAGC
CTGCCGTTCCGCCCGCGGCGGATCACGCCCAAGCCCCGTCCCCACGGCCCGCAGACCGCCGTGGTGGTGG
GGCCCGAGGGCGAGGAGATCTGGACCGACGAATACGGCCGGGTCAAGGTGCAGTTCCACTGGGACCGCTA
CGGCCAGATGAACGAGGAAAGTTCCTGCTGGATCAGGGTGGCCAGCAGCTGGGCCGGCTCGACCTTCGGC
GGCATCTACATCCCGCGGATCGGCCAGGAGGTGATCGTCGACTTCATCGGCGGCGAAATCGACCGGCCGA
TCGTGATCGGCAGCACCTACAACGCCGACCAGATGCCGCCCTTCGAACTGCCGCTGAACTCCAGCCAGAG
CGGTATCGTCACCCGCACGCTGGAGGGAACCCCGGTCAACGGCAATTTCTTTTACTTCGAGGACCGGGCG
GGGGAGGAACTGGTCCGTATCAAGGCCGAACGCGATCACGATACCGAAGTGCTGAACGATACCAATCACT
TCACCGTCAAGACCCACAGCCTGACGGTGGGCGATCTCGAAATCGCGGTCGGCGACGATGGCGGGGGCGC
CACGAGCAATACCATCAACCAACCCCTGAGCGTCGCCGGAGGCGGGAACTTCAACGTGCGGACCGTCAAT
ATCACGATCCGCTCGGCCGTGAATATCGATATTTCCGCGATAAAGGTGGGCGTAGCCGGAGTCAATACGA
GTCTGGATGGAGTGAAGGTTGCCATTGTCGGGGTCAATACGGTTTATAACGGTGCGACTTTCATTCGCAA
TGAGACGATAAAAAAGGAGCACAACTTCTATAAGTCAGAGTCGACGCACCTCGAACACAAAGAGTCGCAT
GCCGTTGAGGAAAAAGGCACGCTTCGCCGGATTCGTTACAATCTCGTGAATTTCAGCAGTGGAACCTTCA
GGGCGGATTATCAAAAGAAAAAGGACGATGCGAAGCAAAAGGCGCGGGATGAGCTTAAAAAGAAAATAGG
GTCGCCGCAATTGCCGCCAGGAACGGCGATATAG