SecReT6
Protein ID: 226944740
SecReT6 ID333
T6SS typei3
Gene symbol-
Locus tagAvin_26620
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]2727153..2728166 [-]
Producthypothetical protein
NoteTssG
UniProt IDC1DJR9
KEGG IDavn:Avin_26620
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.10E-110, Aligned region: 10..314
Protein Sequence: 337 a.a.     [Download]
>gi|226944740|ref|YP_002799813.1| unnamed protein product [Azotobacter vinelandii DJ]
MDAPLWQALRAEPHAHDLFQVLRWLDARAGLPVPLGRAARPQDEPLRLGQRPSLSFAPSMIAGLDETLER
PPYLSIFGFGLFGPHGPLPLHLTEYAHDRERMAGDPTLAAFADLFHHRLILLFYRAWADAQPTVGLDRPG
ANRFEDYIACLLGRGLEAQRDAEPLGRHAIYHQAGHLLRQTRNPEGLQRILSGYFGIPVRIVEYVAHWVA
LEPDARLALGRSGENMGLGTGATLGCAVRDAQSRFRLVLGPMGWADYRRFLPGGDRVPALLHWLREYVGL
ELAWDAQLILAADQVRGTALGEPRPLGLGTWLGRRPADAGDAGDLIIDYSHLGESHV
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|226942170|ref|NC_012560.1|:c2728166-2727153 Azotobacter vinelandii DJ chromosome, complete genome
ATGGACGCTCCGCTGTGGCAGGCGCTGCGCGCCGAGCCGCATGCCCACGACCTGTTCCAGGTGCTGCGCT
GGCTGGATGCCCGCGCCGGCCTGCCGGTCCCGCTGGGACGCGCCGCGCGGCCGCAGGACGAGCCGCTGCG
CCTGGGCCAGCGGCCCTCGCTGTCGTTCGCGCCGTCGATGATCGCCGGTCTGGACGAAACGCTGGAGCGG
CCGCCGTACCTGTCGATCTTCGGCTTCGGCCTGTTCGGCCCCCACGGCCCGCTGCCGCTGCACCTGACCG
AATACGCCCACGACCGCGAGCGCATGGCGGGCGACCCGACCCTGGCCGCCTTCGCCGATCTTTTCCATCA
CCGGCTGATCCTGCTGTTCTACCGCGCCTGGGCCGACGCGCAGCCCACCGTCGGCCTCGACCGCCCCGGC
GCCAACCGCTTCGAGGACTACATCGCCTGCCTGCTGGGCCGGGGGCTGGAGGCGCAACGGGACGCCGAGC
CGCTGGGACGCCACGCCATTTACCACCAGGCCGGCCACCTGCTGCGGCAGACGCGCAACCCGGAAGGCCT
GCAACGGATTCTGAGCGGCTATTTCGGGATACCGGTGCGCATCGTCGAGTACGTGGCGCACTGGGTGGCG
CTGGAGCCGGACGCCCGCCTGGCCCTGGGCCGCAGCGGCGAGAACATGGGCCTGGGCACGGGCGCGACCC
TGGGCTGCGCGGTGCGCGACGCCCAGTCGCGTTTCCGCCTGGTCCTCGGGCCGATGGGCTGGGCGGACTA
CCGCCGTTTTCTGCCCGGCGGCGACCGGGTGCCGGCCCTGCTGCACTGGCTGCGCGAATACGTCGGGCTG
GAACTGGCCTGGGACGCGCAACTGATCCTGGCCGCCGACCAGGTGCGCGGCACCGCCCTCGGCGAGCCGC
GCCCGCTGGGCCTGGGCACCTGGCTCGGCCGGCGGCCGGCGGATGCCGGCGACGCCGGCGATCTGATCAT
CGATTACAGCCACCTGGGGGAGTCCCATGTCTGA