SecReT6
Protein ID: 226944742
SecReT6 ID333
T6SS typei3
Gene symbol-
Locus tagAvin_26640
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]2730052..2730594 [-]
Producthypothetical protein
NoteTssE
UniProt IDC1DJS1
KEGG IDavn:Avin_26640
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-21, Aligned region: 48..159
Protein Sequence: 180 a.a.     [Download]
>gi|226944742|ref|YP_002799815.1| unnamed protein product [Azotobacter vinelandii DJ]
MADPLHTPRDRRQARGKRDRLRPALLDRLTDDEPLQRTEPLTPGASTGELRAAVLRDLAWLFNTISMAAD
LDLAPFGEAQRSVLNYGVLPLAGKRISELDCQELASRLRLAILRFEPRLLPDSVEVLHIDEPDKRLMHHN
ELVFEIRARLWSAPYPVEFRVRSELDLESGQSLLHDLAID
 
Nucleotide Sequence: 543 bp     [Download]
>gi|226942170|ref|NC_012560.1|:c2730594-2730052 Azotobacter vinelandii DJ chromosome, complete genome
ATGGCTGATCCGCTGCACACGCCCAGGGACAGGCGGCAAGCGCGCGGCAAGCGCGACCGCCTGCGCCCGG
CGCTGCTCGACCGTCTGACCGACGACGAGCCCCTGCAACGCACGGAACCCCTGACGCCGGGCGCCAGCAC
CGGCGAGTTGCGCGCCGCGGTGCTGCGCGACCTGGCCTGGCTGTTCAACACCATCAGCATGGCCGCCGAC
CTGGATCTGGCGCCGTTCGGCGAAGCGCAGCGCTCGGTGCTGAACTACGGCGTGCTGCCGCTGGCCGGCA
AGCGCATTTCCGAGCTGGACTGCCAGGAACTCGCCTCCCGGCTGCGCCTGGCCATCCTGCGCTTCGAACC
GCGCCTGCTGCCGGACAGCGTCGAGGTGCTGCACATCGACGAGCCGGACAAGCGGCTCATGCACCACAAC
GAACTGGTCTTCGAGATCCGCGCCCGGCTCTGGTCGGCGCCGTACCCGGTGGAATTCCGCGTGCGTTCCG
AACTGGATCTGGAAAGCGGCCAATCCCTGTTGCACGACCTGGCGATCGACTGA