SecReT6
Protein ID: 226944743
SecReT6 ID333
T6SS typei3
Gene symbol-
Locus tagAvin_26650
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]2730697..2731179 [-]
Producthypothetical protein
NoteTssD
UniProt IDC1DJS2
KEGG IDavn:Avin_26650
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.70E-27, Aligned region: 2..125
Protein Sequence: 160 a.a.     [Download]
>gi|226944743|ref|YP_002799816.1| unnamed protein product [Azotobacter vinelandii DJ]
MHLKIEGVQGESQESQHAAWLDIKSFTWGISQPGSLDSGGGGTPGRASFTDLHVVSYVEASAPTAFKKCA
NGTSLGTVELSCSRLSDGDKMVFMTITLTNVLVTKADIKGVDRDDEQERLLIEYAFQAPEVEFGYTPQQD
DGSAGGEVTMGWNIPQNTEL
 
Nucleotide Sequence: 483 bp     [Download]
>gi|226942170|ref|NC_012560.1|:c2731179-2730697 Azotobacter vinelandii DJ chromosome, complete genome
ATGCACCTGAAGATCGAGGGCGTCCAGGGCGAGTCCCAGGAGTCCCAACACGCTGCCTGGCTCGACATCA
AGTCGTTCACCTGGGGAATCAGCCAGCCCGGCTCCCTGGATTCCGGCGGCGGCGGCACCCCCGGCCGGGC
CAGCTTCACCGACCTGCACGTGGTTTCCTACGTGGAGGCCTCCGCGCCGACCGCGTTCAAGAAGTGCGCC
AACGGCACCAGCCTGGGAACGGTGGAACTGTCCTGCTCCCGGCTCTCCGACGGCGACAAGATGGTCTTCA
TGACCATCACCCTGACCAACGTGCTGGTCACCAAGGCGGACATCAAGGGCGTCGACAGGGACGACGAGCA
GGAGCGCCTGCTCATCGAGTACGCCTTCCAGGCCCCCGAGGTGGAATTCGGCTACACGCCCCAGCAGGAC
GACGGCAGCGCGGGCGGCGAGGTCACCATGGGCTGGAACATCCCCCAGAACACCGAGCTCTGA