SecReT6
Protein ID: 226944744
SecReT6 ID333
T6SS typei3
Gene symbol-
Locus tagAvin_26660
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]2731238..2732740 [-]
Producthypothetical protein
NoteTssC
UniProt IDC1DJS3
KEGG IDavn:Avin_26660
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.60E-194, Aligned region: 67..493
Protein Sequence: 500 a.a.     [Download]
>gi|226944744|ref|YP_002799817.1| unnamed protein product [Azotobacter vinelandii DJ]
MKQIDGALVPGAQLAEYDESEFAALLQKEFRPKTEQARSVVEDAVRTLARQALEQSVGLSGDAYNSIQSI
IAEIDRKLTEQVNLILHHADFQQLEGSWRGLHHLVNNTETDEMLKIRVLPISKKELARNLKRHKGVGWDQ
SPLFKKIYEEEYGQFGGEPYGCLIGDFHFDHSPPDVETLSELARIAAAAHCPVITAAAPSVMQMETWQEL
ANPRDLSKIFQNSEYAAWRALRESEDSRYLALTMPRFLARTPYGSRTNPVDAFDFEEDTDSTNHDRYAWA
NSAYAMGVNINRSFKLYGWCTSIRGVESGGAVENLPYHSFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLVHRKNTNVAAFIGAQSLQKPAEYMDADATTNARLSARLPYLFACCRFAHYLKCIVRDKIGSFQERGD
IERWLNKWIMTYVDGDPLNSSQLTKARKPLAAAEVRVEEQPDNPGYYAAKFFLRPHYQLEGLTVSLRLVS
KLPSVKGSEA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|226942170|ref|NC_012560.1|:c2732740-2731238 Azotobacter vinelandii DJ chromosome, complete genome
ATGAAACAGATCGATGGCGCCCTCGTACCGGGCGCGCAGCTTGCCGAATACGACGAAAGCGAATTCGCCG
CGCTGTTGCAGAAGGAGTTCCGGCCCAAGACGGAACAGGCGCGCAGCGTGGTGGAGGACGCCGTGCGCAC
GCTGGCCCGGCAGGCGCTGGAGCAGAGCGTCGGCCTGTCCGGCGACGCCTACAACAGCATCCAGTCCATC
ATCGCGGAAATCGACCGCAAGCTGACCGAACAGGTGAACCTGATCCTGCACCACGCCGACTTCCAGCAAC
TGGAAGGCAGTTGGCGCGGCCTGCATCACCTGGTCAACAACACCGAAACCGACGAGATGCTGAAGATCCG
CGTGCTGCCGATCTCCAAGAAGGAGCTGGCGCGCAATCTCAAGCGGCACAAAGGCGTGGGCTGGGACCAG
AGCCCGCTGTTCAAGAAGATCTACGAAGAGGAATACGGCCAGTTCGGCGGCGAGCCCTACGGCTGCCTGA
TCGGCGATTTCCATTTCGACCACAGCCCGCCGGACGTGGAAACCCTGAGCGAGCTGGCACGCATCGCCGC
CGCCGCGCACTGCCCGGTGATCACCGCGGCAGCGCCATCGGTCATGCAGATGGAAACCTGGCAGGAACTG
GCCAACCCGCGCGACCTGAGCAAGATCTTCCAGAACAGCGAATACGCCGCCTGGCGCGCCCTGCGCGAGT
CGGAGGACTCGCGCTACCTGGCGCTGACCATGCCGCGCTTCCTGGCCCGCACGCCCTACGGCAGTCGCAC
CAACCCGGTGGACGCGTTCGATTTCGAGGAAGACACCGACAGCACCAACCACGACCGCTACGCCTGGGCC
AACTCGGCCTACGCGATGGGCGTGAACATCAACCGCTCGTTCAAGCTCTACGGCTGGTGTACCTCGATCC
GCGGCGTGGAAAGCGGCGGGGCGGTGGAAAACCTGCCGTACCACAGTTTTCCCACCGACGACGGCGGGGT
GGACATGAAATGTCCCACCGAGATCGCCATCAGCGACCGCCGCGAGGCGGAACTGGCCAAGAACGGTTTC
ATGCCGCTGGTCCACCGCAAGAACACCAACGTCGCCGCTTTCATCGGCGCCCAGTCGCTGCAGAAACCCG
CCGAATACATGGATGCCGACGCCACCACCAACGCCCGGCTGTCGGCGCGCCTGCCCTATCTGTTCGCCTG
CTGCCGCTTCGCGCATTACCTCAAGTGCATCGTGCGCGACAAGATCGGTTCCTTCCAGGAGCGCGGCGAC
ATCGAGCGCTGGCTCAACAAATGGATCATGACCTATGTGGACGGCGATCCGCTCAATTCCTCGCAACTGA
CCAAGGCCAGGAAGCCCCTGGCCGCCGCCGAGGTGCGCGTCGAGGAGCAGCCGGACAACCCGGGCTACTA
CGCGGCCAAGTTCTTCCTGCGTCCCCACTACCAGCTCGAAGGGTTGACCGTGTCCCTGCGGCTGGTCTCG
AAACTGCCGTCGGTGAAGGGCAGCGAAGCCTGA