SecReT6
Protein ID: 226944745
SecReT6 ID333
T6SS typei3
Gene symbol-
Locus tagAvin_26670
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]2732754..2733320 [-]
Producthypothetical protein
NoteTssB
UniProt IDC1DJS4
KEGG IDavn:Avin_26670
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-60, Aligned region: 18..169
Protein Sequence: 188 a.a.     [Download]
>gi|226944745|ref|YP_002799818.1| unnamed protein product [Azotobacter vinelandii DJ]
MADIRKNSPQKDSGQKFVGRNRSPRVQIEYDVEIYGSDRKVQLPFVMGVMADLTGKQVEPLPELAERKFV
EIDIDNFDDRMESLKPRVAFGVPNTLTGDGQLLVDLTFEQLDDFSPAQVAHKIEPLRKLLEARTQLANLM
SYMDGKTGAEELIAQVLQDPALLETLATNPRVPREADQPVRDEQAQES
 
Nucleotide Sequence: 567 bp     [Download]
>gi|226942170|ref|NC_012560.1|:c2733320-2732754 Azotobacter vinelandii DJ chromosome, complete genome
ATGGCTGATATCCGCAAAAACTCGCCCCAGAAAGACAGCGGTCAGAAGTTCGTCGGACGCAATCGCTCGC
CGCGCGTGCAGATCGAGTACGACGTCGAAATCTACGGCTCGGACCGCAAGGTGCAGCTTCCCTTCGTGAT
GGGCGTCATGGCGGACCTGACCGGCAAGCAGGTCGAGCCCCTGCCGGAACTGGCCGAGCGCAAGTTCGTG
GAAATCGACATCGACAACTTCGACGACCGCATGGAGTCGCTCAAGCCGCGCGTGGCCTTCGGCGTGCCCA
ACACCCTGACCGGCGATGGCCAGTTGCTGGTCGACCTGACCTTCGAGCAACTGGACGACTTTTCCCCGGC
CCAGGTGGCGCACAAGATCGAGCCGCTGCGCAAGCTGCTGGAGGCGCGTACCCAGTTGGCCAACCTGATG
TCCTACATGGACGGCAAGACCGGCGCCGAGGAACTGATCGCCCAGGTACTGCAGGACCCGGCCCTGCTGG
AAACCCTGGCCACCAACCCGAGGGTGCCGCGCGAGGCGGACCAGCCGGTCCGCGACGAGCAGGCGCAGGA
ATCCTGA