SecReT6
Protein ID: 226944746
SecReT6 ID333
T6SS typei3
Gene symbol-
Locus tagAvin_26680
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]2733396..2734430 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDC1DJS5
KEGG IDavn:Avin_26680
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.90E-22, Aligned region: 58..117
Protein Sequence: 344 a.a.     [Download]
>gi|226944746|ref|YP_002799819.1| unnamed protein product [Azotobacter vinelandii DJ]
MSTSCPEHLLPLLAPVSDERPCGDNLEYAAEFLQLMQAVQPRAEQQYGRTIIPAEEPDWRAVAQQAERLL
ATSKDLRIAVLLSRAWTELRGLAGYADGMRLVAALLDGHWDGLHPLLEEDGETDPLPRHNALSGLFDPQL
CLRALRAAPLAAVGGLTLREVGLLLEGNAPEQLDYPGGRERAQAELARAWEMADPELRAVPEILQALGAI
AERLRASLGEGWLPDSAELEKLLLRLLEASRGTSPAAAAESPSAGDEAAGSASPAAFAPAAVDWRTAELD
SRADVNLLLEKICVYLERHEPSHPAPILLRRAQRLMQLGFYDILRDLAPASLAQIDLLIGKAPS
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|226942170|ref|NC_012560.1|:c2734430-2733396 Azotobacter vinelandii DJ chromosome, complete genome
ATGTCCACGTCATGCCCGGAACATCTGCTTCCCCTGCTGGCCCCGGTGAGCGACGAGCGGCCGTGCGGCG
ACAATCTCGAATACGCGGCGGAGTTCCTGCAGTTGATGCAGGCCGTCCAGCCCAGGGCCGAGCAGCAGTA
TGGCCGCACCATCATCCCGGCCGAAGAGCCGGACTGGCGGGCGGTGGCGCAGCAGGCCGAACGCCTGTTG
GCGACCAGCAAGGACCTGCGCATCGCCGTCCTGCTGAGCCGCGCCTGGACCGAATTGCGCGGGCTGGCCG
GCTACGCCGACGGCATGCGCCTGGTCGCCGCGCTGCTCGACGGCCACTGGGACGGACTGCATCCGCTGCT
CGAGGAGGACGGCGAGACGGACCCCTTGCCGCGCCACAACGCGCTGTCCGGCCTGTTCGACCCGCAGCTC
TGCCTGCGCGCGCTGCGCGCCGCGCCGCTGGCCGCCGTGGGAGGGCTGACGCTGCGCGAGGTCGGCCTGC
TGCTCGAAGGCAACGCCCCGGAGCAGCTCGATTATCCCGGCGGGCGCGAGCGCGCGCAGGCCGAACTGGC
CCGTGCCTGGGAGATGGCCGACCCGGAGCTGCGAGCCGTGCCCGAGATCCTGCAGGCCCTGGGCGCTATC
GCCGAGCGGCTGCGCGCCAGCCTCGGCGAGGGCTGGCTGCCCGACAGCGCCGAGCTGGAAAAACTTCTGC
TGCGCCTGCTGGAGGCCTCCCGCGGCACGTCGCCGGCGGCCGCCGCCGAAAGCCCGTCCGCCGGCGACGA
GGCAGCGGGGAGCGCATCCCCGGCCGCGTTCGCGCCGGCCGCCGTCGACTGGCGCACGGCGGAGCTGGAC
AGCCGCGCCGATGTGAATCTCTTGCTGGAAAAGATCTGCGTCTACCTGGAGCGCCACGAGCCCAGCCATC
CGGCGCCGATTCTGCTGCGCCGCGCGCAGCGGCTCATGCAGCTCGGTTTCTACGACATCCTGCGCGACCT
GGCTCCGGCCAGCCTGGCGCAGATCGATCTGCTGATCGGCAAGGCACCTTCGTGA