SecReT6
Protein ID: 226944750
SecReT6 ID333
T6SS typei3
Gene symbol-
Locus tagAvin_26720
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]2740526..2741818 [-]
Producthypothetical protein
NoteTssL
UniProt IDC1DJS9
KEGG IDavn:Avin_26720
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-76, Aligned region: 47..252
DUF2077 [PF09850], Evalue: 1.00E-76, Aligned region: 372..415
OmpA [PF00691], Evalue: 6.00E-15, Aligned region: 316..414
Lipase_GDSL_2 [PF13472], Evalue: 6.30E-05, Aligned region: 131..210
Protein Sequence: 430 a.a.     [Download]
>gi|226944750|ref|YP_002799823.1| unnamed protein product [Azotobacter vinelandii DJ]
MGDTRMNLHADTFFDPLKPSASPAPERGDDGQEQSATPAQPIVSGGNPLVAAANPLLNLVPQIGGTPQHP
DPPQLRERLLDEIRQFEVRARAAGVPAETVMGARYCLCTTLDEAATLTPWGGGGVWSAHSLLVSFHNETW
GGEKFFQLLARLSQAPQEHIDLLELQYFCLMLGFEGRYRVLDQGRSQLEALKQRLLQLIRKVRGEYPAAL
SPHWHDPVAAPPRVRRSLPVWVGAALAALLCLGLFATFQWLLAGRSDAAFAAIDQLRLPRVLAVAPTPAA
PEPRLAKLLEAEIRDGLVRVSDEVDRSLVVLRGDGLFDSGAAQVIERFQPLLARIGDALNTTRGSVLVMG
YTDNVPIRGLRYASNWELSQARADTVKAQLQARLSDPGRVRAEGRGAADPVAPNDSPANRARNRRVEITL
LVPPGTEARP
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|226942170|ref|NC_012560.1|:c2741818-2740526 Azotobacter vinelandii DJ chromosome, complete genome
CTGGGCGATACGCGAATGAACCTGCACGCCGATACCTTCTTCGATCCTCTGAAGCCTTCGGCCAGCCCGG
CGCCGGAGCGGGGCGACGACGGCCAGGAGCAGTCCGCCACCCCGGCGCAGCCCATCGTCAGCGGCGGCAA
CCCGCTGGTGGCCGCGGCCAATCCGCTGCTCAATCTGGTGCCGCAGATCGGCGGCACCCCGCAGCATCCC
GACCCGCCGCAACTGCGTGAGCGACTGCTCGACGAAATCCGCCAGTTCGAGGTGCGCGCGCGCGCCGCCG
GCGTGCCGGCGGAGACCGTGATGGGCGCGCGCTACTGCCTGTGCACCACCCTGGACGAGGCCGCCACCCT
GACCCCCTGGGGCGGCGGTGGGGTCTGGTCGGCGCACAGCCTGCTGGTCAGCTTCCACAACGAGACCTGG
GGCGGCGAGAAGTTCTTCCAGTTGCTGGCGCGGCTGTCCCAGGCCCCGCAGGAGCACATCGATCTGCTGG
AGCTGCAGTATTTCTGCTTGATGCTCGGCTTCGAGGGCCGCTACCGGGTGCTGGACCAGGGCCGCTCGCA
GCTCGAAGCGCTCAAGCAGCGCCTGCTGCAGTTGATCCGCAAGGTCCGCGGCGAATATCCGGCCGCGCTT
TCACCGCACTGGCACGATCCGGTCGCGGCGCCGCCCAGGGTGCGCCGCAGCCTGCCGGTCTGGGTCGGCG
CCGCGCTCGCCGCCCTGCTGTGCCTGGGCCTGTTCGCCACCTTCCAGTGGCTGCTGGCCGGCCGTTCGGA
CGCGGCCTTCGCCGCCATCGACCAGTTGCGCCTGCCGCGCGTGCTCGCCGTCGCGCCGACGCCCGCGGCC
CCCGAGCCGCGCCTGGCGAAACTGCTGGAGGCGGAGATCCGCGACGGCCTGGTGCGGGTGAGCGACGAGG
TCGACCGCAGCCTGGTCGTGCTGCGCGGCGACGGCCTGTTCGATTCCGGCGCGGCGCAGGTGATCGAGCG
CTTCCAGCCCCTGCTGGCGCGCATCGGCGACGCCCTGAACACCACCCGCGGCAGCGTGCTGGTGATGGGC
TACACGGACAACGTGCCGATCCGCGGCCTGCGCTACGCCTCCAACTGGGAGCTGTCCCAGGCCCGCGCCG
ATACCGTCAAGGCGCAGTTGCAGGCGCGTCTCTCCGACCCCGGACGGGTGCGCGCCGAAGGGCGGGGCGC
CGCCGACCCGGTGGCGCCCAACGACAGCCCGGCCAATCGCGCACGCAACCGGCGGGTGGAAATCACCCTG
CTGGTGCCCCCCGGAACGGAGGCACGGCCATGA