SecReT6
Protein ID: 226944751
SecReT6 ID333
T6SS typei3
Gene symbol-
Locus tagAvin_26730
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]2741800..2743167 [-]
Producthypothetical protein
NoteTssK
UniProt IDC1DJT0
KEGG IDavn:Avin_26730
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.70E-156, Aligned region: 30..454
Protein Sequence: 455 a.a.     [Download]
>gi|226944751|ref|YP_002799824.1| unnamed protein product [Azotobacter vinelandii DJ]
MKFHSPISTIPAVLRQRVVWSEGMFLRPQHFQQLERYLEHYVQARCLPTQGFHWGWQQLEVDRQALALGK
VALLGGSGTMPDGTPFAFGGDDAPAALEIPADLKNQTLVLALPLWRAGASETGWSRDGEPAWSRYRVTDF
EVPDANSEPFGPALLQVGRLDLRLMTEAALNGDWQSLGLVRVLERRNDGQVLLDEEYIPPLLSATRHPVL
RGCLDELHGLLRQRGEALAERLAQPGRGGVAEVGDFLLLALVNRYTAVTWRARQAACVHPSRLFDEWLEL
ASELATHTHERRRPQVFPEYRHDALRDSFAPLMAELRRALSSVLEQHAIAIALQERGSGVCVAQIPSLEL
IREAGFVLAVHADVPAETLRARFPAQLKLGAVERIRDLVSLQLPGIGVRLLPVAPRQLPYHAGHSYFELE
KGSEFWKQLEKSGSLALHVAGEFPGLKMEFWAIRE
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|226942170|ref|NC_012560.1|:c2743167-2741800 Azotobacter vinelandii DJ chromosome, complete genome
ATGAAATTCCATAGTCCGATTTCCACGATTCCCGCTGTATTGCGCCAACGTGTGGTGTGGAGCGAGGGCA
TGTTTCTCCGGCCCCAGCATTTCCAGCAGTTGGAGCGTTATCTCGAGCATTACGTGCAGGCGCGTTGCCT
GCCCACGCAGGGATTCCACTGGGGCTGGCAGCAACTGGAAGTCGATCGCCAGGCGCTGGCGCTGGGCAAG
GTCGCCCTGCTCGGCGGGAGCGGAACGATGCCGGACGGCACGCCCTTCGCCTTCGGCGGCGACGATGCGC
CGGCGGCGCTGGAGATTCCCGCCGACCTCAAGAACCAGACCCTGGTGCTGGCGCTGCCGCTGTGGCGCGC
CGGGGCCAGCGAGACGGGCTGGAGCCGGGACGGCGAGCCGGCCTGGAGCCGCTACCGGGTGACGGATTTC
GAGGTCCCGGATGCCAACAGCGAGCCGTTCGGTCCCGCGCTCCTGCAGGTGGGACGGCTCGATCTGCGCC
TGATGACGGAAGCGGCCCTGAACGGCGACTGGCAGTCGCTCGGCCTGGTCCGCGTGCTGGAGCGGCGCAA
CGACGGCCAGGTGCTGCTGGACGAGGAGTACATCCCGCCGCTGCTCTCGGCCACGCGCCACCCGGTGCTG
CGCGGCTGCCTGGACGAACTGCACGGCCTGCTGCGGCAGCGCGGCGAGGCGCTGGCCGAACGCCTCGCCC
AGCCGGGACGCGGCGGCGTGGCCGAAGTGGGCGACTTCCTGCTGCTGGCGCTGGTCAACCGCTACACGGC
CGTGACCTGGCGCGCGCGCCAGGCGGCCTGCGTGCATCCCTCGCGACTGTTCGACGAGTGGCTCGAACTG
GCCAGCGAACTGGCGACCCACACCCACGAGCGGCGCCGCCCCCAGGTGTTTCCCGAGTACCGCCACGACG
CGCTGCGGGACAGCTTCGCGCCGCTGATGGCGGAGCTGCGCCGCGCCCTGTCCAGCGTGCTGGAGCAGCA
CGCCATCGCGATTGCCCTGCAGGAGCGCGGCAGCGGCGTGTGCGTGGCGCAGATCCCGTCGCTGGAACTG
ATCCGCGAGGCCGGCTTCGTGCTGGCGGTACATGCCGACGTGCCCGCCGAAACCCTGCGCGCGCGCTTTC
CGGCGCAGCTCAAGCTGGGCGCGGTGGAGCGCATCCGCGACCTGGTTTCGCTGCAACTGCCGGGCATCGG
TGTGCGCCTGTTGCCGGTGGCGCCGCGGCAACTGCCTTACCACGCCGGCCACAGCTATTTCGAGCTGGAG
AAGGGCAGCGAATTCTGGAAGCAACTGGAGAAGTCGGGAAGCCTGGCGCTGCACGTGGCCGGCGAGTTTC
CCGGTTTGAAGATGGAATTCTGGGCGATACGCGAATGA