SecReT6
Protein ID: 226944752
SecReT6 ID333
T6SS typei3
Gene symbol-
Locus tagAvin_26740
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]2743164..2743742 [-]
Producthypothetical protein
NoteTssJ
UniProt IDC1DJT1
KEGG IDavn:Avin_26740
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-34, Aligned region: 35..170
Protein Sequence: 192 a.a.     [Download]
>gi|226944752|ref|YP_002799825.1| unnamed protein product [Azotobacter vinelandii DJ]
MLLVLRDFVLPSVTGKFGFLPIGAPVPALLLVSGLLSGCGSTPPPLAPAIPYQLKLNAGGNINPDILGRP
SPIVVRVFELRSGGAFESSDFFSLQDKPELVLGRELIGVEQVTLYPGEVRYVTGAGSPDARNIGILAEYR
ELDAKRWRRLIGLPLPRQSNSWFFWRSSPDRLSLSVDINNDGVDFLPVAHKQ
 
Nucleotide Sequence: 579 bp     [Download]
>gi|226942170|ref|NC_012560.1|:c2743742-2743164 Azotobacter vinelandii DJ chromosome, complete genome
ATGTTGCTTGTGTTGCGTGATTTCGTTTTGCCATCCGTCACGGGAAAGTTCGGATTCCTGCCGATCGGAG
CGCCCGTTCCGGCGCTCCTGCTGGTTTCCGGCCTGCTGTCCGGGTGCGGCTCGACGCCGCCTCCGCTGGC
CCCGGCGATACCCTATCAACTGAAGCTGAATGCCGGCGGAAATATCAATCCCGATATTCTCGGGCGACCG
TCGCCGATTGTGGTGAGAGTGTTCGAGTTGCGTTCGGGCGGTGCCTTCGAATCGAGCGACTTCTTCAGTC
TGCAGGATAAGCCGGAACTTGTCCTGGGCCGGGAGTTGATAGGCGTGGAGCAGGTGACCCTGTATCCCGG
AGAGGTGAGATATGTGACGGGAGCCGGCAGTCCGGATGCGCGGAATATCGGCATCCTGGCCGAATACCGG
GAGTTGGATGCCAAGCGCTGGCGACGCCTGATCGGCTTGCCATTGCCCCGACAGTCGAACTCCTGGTTTT
TCTGGCGAAGTTCGCCGGATCGATTGAGCCTGTCCGTGGATATCAATAACGATGGTGTCGATTTCTTGCC
GGTTGCACATAAACAATGA