SecReT6
Protein ID: 226944754
SecReT6 ID333
T6SS typei3
Gene symbol-
Locus tagAvin_26770
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]2744487..2746184 [+]
Producthypothetical protein
NoteFha
UniProt IDC1DJT3
KEGG IDavn:Avin_26770
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.00E-06, Aligned region: 27..94
Protein Sequence: 565 a.a.     [Download]
>gi|226944754|ref|YP_002799827.1| unnamed protein product [Azotobacter vinelandii DJ]
MRLTVLEYGGEAPSPPLSMLFSAPGGTIGRGADNHLVLPDDTRQISRLQAVLQVGEAGAQLKNLSPVCPI
EINEKPLAQQEEHPLCAGDIVRIGAYLLRAETAAPAQPALAPPPAEPMAAFAEAETALSPPGADSPPGAP
MSETPAPREPAGDTSAAPSPPERAALAEEAPASGMDAAPAGRADGEAAPAGQPEAQPERDEVPASAAVPE
AFWENLIAEFARHPAPESLSPADEIQAPLASGQAETTVATEDTLAALNRIPVDPLALFDATPGEDPDALF
DDSPSALAGPPAIPLDIRPTGPVVAPQANRVAELNGHFQAPRVGPRREGPPATGAGPSARPDDPPGGAPT
GGDPAAHGKAKTTKDAAGAFREGAGLEASYALGDEQLHCAGRLLASLLGGTMALLSSRTIIKREVKADLT
LILERENNPLKLLPDANTVLKQMFGPPFPGFMAPEQAVDDAFHDLQAHQIGMLAGMRAALRQLLHKVSPA
LVEQQLGAPDWRERLLPGGRDSRAWAHYRNLHQAMLTALEEDFHTVFGQAFLAAYDAEVELYRQQCRRTA
CHRNA
 
Nucleotide Sequence: 1698 bp     [Download]
>gi|226942170|ref|NC_012560.1|:2744487-2746184 Azotobacter vinelandii DJ chromosome, complete genome
ATGCGATTGACCGTACTCGAATACGGTGGAGAGGCGCCCAGCCCGCCACTGAGCATGTTGTTCAGCGCCC
CCGGCGGCACCATCGGGCGAGGCGCCGACAACCATCTGGTACTGCCCGACGACACACGACAGATCTCCAG
GCTGCAGGCCGTGCTGCAGGTGGGCGAGGCCGGCGCGCAACTGAAAAACCTCAGCCCCGTCTGCCCGATC
GAAATCAACGAAAAACCGCTGGCGCAGCAGGAGGAACATCCCCTGTGCGCCGGCGACATCGTGCGTATCG
GCGCCTACCTGCTGCGCGCGGAAACGGCCGCCCCCGCACAGCCAGCGCTCGCTCCGCCGCCGGCCGAGCC
GATGGCGGCGTTCGCCGAGGCCGAGACGGCGCTGTCCCCGCCCGGCGCGGATTCGCCCCCGGGCGCGCCC
ATGAGCGAAACGCCGGCGCCGCGGGAACCGGCCGGCGATACCTCGGCAGCCCCGTCGCCGCCCGAGCGCG
CGGCGCTCGCCGAGGAGGCGCCGGCCAGCGGGATGGACGCCGCGCCGGCAGGCCGCGCCGATGGCGAGGC
GGCGCCTGCCGGCCAGCCCGAGGCCCAGCCCGAGCGCGACGAGGTGCCCGCCAGCGCAGCCGTCCCGGAA
GCCTTCTGGGAAAACCTGATCGCGGAGTTCGCCCGGCATCCCGCGCCCGAAAGCCTGAGCCCCGCCGACG
AAATCCAGGCCCCCCTGGCTTCCGGGCAGGCCGAAACGACGGTTGCGACCGAAGATACGCTGGCCGCCCT
GAACAGGATTCCCGTCGATCCCCTGGCGCTGTTCGATGCCACTCCCGGCGAGGACCCGGACGCGCTTTTC
GACGACAGTCCCAGCGCCCTGGCCGGGCCGCCCGCCATCCCGCTCGATATCCGCCCGACAGGGCCCGTCG
TCGCGCCGCAGGCGAATCGCGTGGCGGAACTGAACGGCCACTTCCAGGCGCCCCGCGTCGGGCCACGCCG
GGAAGGGCCGCCGGCGACCGGCGCCGGCCCGTCGGCGCGGCCGGACGATCCGCCGGGCGGCGCTCCGACG
GGCGGCGACCCGGCCGCGCACGGCAAGGCGAAAACCACGAAAGACGCCGCCGGCGCCTTCCGCGAGGGCG
CCGGTCTCGAAGCCAGCTATGCCCTGGGCGACGAACAATTGCACTGCGCCGGGCGCCTGCTCGCCAGCCT
GCTCGGCGGCACCATGGCCCTGCTCTCCAGCCGCACCATCATCAAGCGCGAGGTCAAGGCCGACCTGACC
CTGATCCTTGAGCGGGAAAACAACCCGCTCAAGCTGCTGCCCGACGCAAACACGGTGCTGAAACAGATGT
TCGGCCCGCCGTTTCCGGGCTTCATGGCGCCGGAGCAGGCCGTGGACGACGCCTTCCACGACCTGCAGGC
GCACCAGATCGGCATGCTGGCCGGCATGCGCGCGGCCCTGCGGCAGTTATTGCACAAGGTCAGCCCCGCC
CTCGTCGAGCAGCAACTGGGCGCCCCCGACTGGCGCGAGCGGCTGCTGCCGGGCGGCCGCGACAGCCGGG
CCTGGGCGCACTACCGCAACCTGCACCAGGCCATGCTGACGGCGCTGGAGGAAGACTTCCATACGGTGTT
CGGCCAGGCTTTCCTCGCCGCCTACGACGCGGAGGTCGAACTCTATCGCCAGCAATGCCGCCGAACCGCC
TGCCACAGGAATGCCTGA