SecReT6
Protein ID: 226947064
SecReT6 ID334
T6SS typei4a
Gene symbol-
Locus tagAvin_50750
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]5141501..5142592 [-]
ProductImpA-like protein
NoteTssA
UniProt IDC1DM85
KEGG IDavn:Avin_50750
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.70E-22, Aligned region: 61..121
ImpA-rel_N [PF06812], Evalue: 3.70E-22, Aligned region: 210..237
ImpA-rel_N [PF06812], Evalue: 3.70E-22, Aligned region: 238..257
Protein Sequence: 363 a.a.     [Download]
>gi|226947064|ref|YP_002802137.1| unnamed protein product [Azotobacter vinelandii DJ]
MSSSLSLPLPPDSLLEPLSADSPCGPSLRYDPDFDRLREARREEDASLPSGVWQARIKLGDWATVERLAG
ELLRTRSKDLMVAAWLGEAWLLRRNWEGLPQALALVSGLCERYPDELHPQAEEGDRSWRATPLDWLIRRY
AELSLVRLPLFEPDDESAPFALHDWRQLQLQQVAADDGKAAKAAVEAARQKQRKLDERIRSTPLPVWLRR
RACLEQSACTLERLERWSDEYLGELAPGFAPLRETIRQLIALMQEFIAMHPRASEAAAAPSPAGEAESAS
AAPTVAMPGVATPSGPPGSREQAYRQLGLIADYLARTEPHSPVPYLIRKAMEWGDKPLGDLLSELLSADP
EARRVWTLLGILK
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|226942170|ref|NC_012560.1|:c5142592-5141501 Azotobacter vinelandii DJ chromosome, complete genome
TTGAGTTCTTCGCTTTCCCTGCCCTTGCCGCCGGACAGCCTGCTCGAACCGCTCTCGGCGGACTCGCCCT
GCGGTCCGAGCCTGCGCTACGACCCGGATTTCGACCGCCTGCGCGAGGCTCGCCGGGAGGAGGATGCGAG
CCTGCCGAGCGGCGTCTGGCAGGCACGGATCAAACTCGGCGACTGGGCGACGGTAGAGAGGCTGGCCGGC
GAACTGCTGCGCACCCGCAGCAAGGACCTGATGGTGGCCGCCTGGCTGGGCGAGGCCTGGCTGCTGCGCA
GGAACTGGGAAGGGCTGCCCCAGGCGCTGGCGCTGGTGAGCGGTCTGTGCGAACGCTATCCGGACGAGCT
GCACCCGCAGGCCGAGGAGGGCGACCGCTCCTGGCGGGCGACGCCGCTCGACTGGCTGATCCGCCGCTAC
GCCGAGCTGTCGCTGGTCCGCCTGCCGCTGTTCGAGCCGGACGACGAGTCCGCCCCCTTCGCCCTGCACG
ACTGGCGGCAACTGCAGTTGCAGCAGGTCGCCGCCGACGACGGCAAGGCGGCCAAGGCCGCAGTCGAGGC
GGCCCGGCAGAAACAGCGCAAGCTGGACGAGCGGATCAGGAGCACGCCGCTGCCGGTCTGGCTGCGCCGC
CGCGCCTGTCTCGAACAGAGCGCGTGCACGCTGGAGCGTCTGGAGCGCTGGAGCGACGAGTACCTGGGCG
AACTCGCTCCCGGTTTCGCTCCTTTGCGCGAGACCATCCGCCAACTGATCGCCCTGATGCAGGAGTTCAT
CGCCATGCACCCACGAGCATCCGAGGCCGCCGCCGCTCCATCCCCGGCCGGGGAGGCCGAATCGGCCAGC
GCCGCGCCGACCGTCGCCATGCCGGGCGTCGCCACGCCCTCCGGCCCGCCAGGCAGCCGCGAGCAGGCCT
ACCGTCAATTGGGCCTGATCGCCGATTATCTGGCACGTACCGAGCCGCACAGTCCGGTTCCTTACCTGAT
CCGCAAGGCGATGGAGTGGGGCGACAAGCCCCTCGGCGATCTGTTGTCCGAACTGCTGTCGGCGGACCCG
GAGGCCCGGCGCGTCTGGACCCTGCTGGGTATCCTGAAGTGA