SecReT6
Protein ID: 226947066
SecReT6 ID334
T6SS typei4a
Gene symbol-
Locus tagAvin_50770
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]5146423..5147187 [-]
Producthypothetical protein
NoteTssL
UniProt IDC1DM87
KEGG IDavn:Avin_50770
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.50E-43, Aligned region: 17..228
Protein Sequence: 254 a.a.     [Download]
>gi|226947066|ref|YP_002802139.1| unnamed protein product [Azotobacter vinelandii DJ]
MLEQEIDPYAPGPGEAPLSSAFGQAWREWLAVRRELEGEEAGEAELVARFAEQAGRIARRLWRTAFAGAG
DAPHQVKEMVYAFVALIDETLLFAPWPGQAAWQEKPLELRLYGSRKAGERIPLAIRKVLAERAPATRDLA
NVYLQCLILGFQGHLRSPRGQALHEKWRHALFDFAWLREPAMSDAVELLGRPAAVAPVRLPVRRSLPDGL
RLGLAILGMAVLLTLLGHLFWRDIAGSLEPVLSVEVALTAERVP
 
Nucleotide Sequence: 765 bp     [Download]
>gi|226942170|ref|NC_012560.1|:c5147187-5146423 Azotobacter vinelandii DJ chromosome, complete genome
ATGCTCGAGCAGGAGATCGACCCCTATGCGCCGGGTCCCGGCGAGGCGCCCCTGAGTTCCGCCTTTGGCC
AGGCCTGGCGCGAATGGCTGGCCGTCCGGCGCGAGCTGGAGGGCGAGGAGGCCGGCGAGGCCGAACTGGT
CGCGCGCTTCGCCGAACAGGCCGGGCGCATCGCCCGCCGGCTCTGGCGCACGGCCTTCGCCGGCGCCGGC
GACGCGCCGCATCAGGTGAAGGAGATGGTCTACGCTTTCGTCGCCCTGATCGACGAGACGCTGCTGTTCG
CTCCCTGGCCGGGCCAGGCGGCCTGGCAGGAGAAGCCGCTGGAGCTGCGTCTGTACGGTAGCCGCAAGGC
CGGCGAGCGCATCCCGCTGGCGATCAGGAAGGTCCTCGCCGAGCGCGCGCCGGCCACCCGGGACCTTGCC
AACGTCTACCTGCAATGCCTGATCCTCGGCTTCCAGGGCCATCTGCGCAGCCCACGCGGCCAGGCCCTGC
ACGAGAAATGGCGGCATGCGCTGTTCGACTTCGCCTGGCTGCGCGAGCCCGCCATGAGCGATGCGGTCGA
ACTGCTCGGCCGCCCGGCGGCCGTGGCGCCCGTGCGCCTGCCGGTCCGCCGTTCGCTGCCCGACGGCCTG
CGCCTCGGCCTGGCGATCCTGGGCATGGCGGTACTGCTGACGCTGCTCGGCCATCTGTTCTGGCGCGACA
TCGCCGGTTCGCTGGAGCCAGTGCTGTCCGTCGAGGTGGCGCTGACGGCGGAGCGGGTGCCATGA