SecReT6
Protein ID: 226947067
SecReT6 ID334
T6SS typei4a
Gene symbol-
Locus tagAvin_50780
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]5147205..5148530 [-]
Producthypothetical protein
NoteTssK
UniProt IDC1DM88
KEGG IDavn:Avin_50780
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.80E-68, Aligned region: 20..411
Protein Sequence: 441 a.a.     [Download]
>gi|226947067|ref|YP_002802140.1| unnamed protein product [Azotobacter vinelandii DJ]
MSVLPEAVCWHEGMQLLPQHFQLQGLRAEALAGHLARVCNPWFWGVETLEVDPAALCAGRVRVTALEATL
PDGLPVGLSADGGAPLELDLAEAFADSAAGVTVYLAVTPLGRAGQLLPLNGRLRSVVGDALPDLASGEHP
EPIVVWRPNPRLVTAEGRADSVCIPLLRVGREGGGYVRLPYVAPMPRILPESPLGEKVRALCARAREKCL
FLAGRLRQARQAGNAEDAAELRLQLAALWARLPEVEAALNGRGTDPATLHRLLAGMAGAWCALDPLAGVP
AFRPLEFEDLLRGYDEVLGWLAATLARIRAGYRSLPFEQDRHGFHILLPDRERPGQRLAIGLRMPAGTGE
QAARDWLAQAIVASEAHVATLVRQRMGGLSWHPMPRQEQVAYGVGEDTRIFVLKAAGEWFDPSQALRIVP
CGGAAGGQPWQIVLFADAGDR
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|226942170|ref|NC_012560.1|:c5148530-5147205 Azotobacter vinelandii DJ chromosome, complete genome
ATGAGTGTTCTACCCGAGGCGGTCTGCTGGCACGAGGGCATGCAGTTGCTGCCCCAGCATTTCCAGCTCC
AGGGCTTGCGCGCGGAAGCCCTGGCGGGACACCTGGCCAGGGTCTGCAATCCCTGGTTCTGGGGCGTCGA
GACGCTGGAGGTCGATCCTGCCGCCCTCTGTGCCGGTCGGGTGCGGGTGACCGCCCTCGAAGCCACCCTG
CCGGACGGCCTGCCGGTCGGCCTGAGCGCCGACGGCGGTGCGCCGCTGGAACTGGATCTGGCCGAGGCGT
TCGCCGACTCGGCCGCCGGCGTGACCGTCTACCTCGCCGTGACGCCGCTGGGACGGGCCGGCCAGTTGCT
GCCGCTGAACGGACGCCTGCGCTCGGTGGTCGGTGACGCGCTGCCCGATCTGGCCAGCGGCGAGCATCCC
GAGCCGATCGTCGTCTGGCGGCCGAATCCGCGCCTGGTCACCGCCGAAGGACGGGCCGACTCGGTGTGCA
TTCCCCTGCTGCGAGTGGGGCGGGAGGGCGGCGGCTATGTTCGTTTGCCCTATGTCGCCCCGATGCCGCG
CATCCTCCCGGAGTCGCCGCTGGGCGAAAAGGTGCGGGCCCTGTGCGCCCGCGCCCGGGAGAAGTGCCTG
TTCCTCGCCGGGCGGCTGCGCCAGGCCCGGCAGGCCGGCAACGCCGAAGACGCCGCCGAGCTTCGCCTGC
AACTGGCGGCCCTGTGGGCGCGACTGCCCGAGGTGGAGGCGGCCTTGAACGGACGCGGCACCGATCCGGC
GACCCTGCACCGGCTGCTGGCCGGCATGGCCGGCGCCTGGTGCGCGCTCGATCCGTTGGCCGGCGTCCCG
GCGTTCCGTCCCCTGGAGTTCGAGGACCTGCTGCGCGGCTACGACGAGGTGCTCGGCTGGCTGGCGGCGA
CGCTGGCGCGGATCCGCGCGGGCTACCGGAGCCTGCCGTTCGAGCAGGACCGGCATGGCTTCCATATCCT
CCTGCCGGATCGGGAGCGGCCCGGCCAGCGCCTGGCGATCGGCCTGCGCATGCCGGCCGGGACCGGCGAG
CAGGCGGCCCGGGACTGGCTGGCGCAAGCCATCGTCGCTTCCGAGGCGCATGTCGCGACTCTGGTTCGCC
AGCGCATGGGCGGGCTTTCCTGGCATCCCATGCCCCGGCAGGAACAGGTCGCCTACGGGGTCGGCGAGGA
CACGCGGATCTTCGTGCTCAAGGCGGCCGGCGAGTGGTTCGATCCGAGCCAGGCGCTGCGCATCGTGCCC
TGCGGCGGCGCGGCCGGCGGCCAGCCCTGGCAGATCGTGCTGTTCGCCGACGCCGGCGACCGCTAG