SecReT6
Protein ID: 226947069
SecReT6 ID334
T6SS typei4a
Gene symbol-
Locus tagAvin_50800
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]5149261..5149824 [+]
Producthypothetical protein
NoteTssB
UniProt IDC1DM90
KEGG IDavn:Avin_50800
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.70E-55, Aligned region: 9..161
Protein Sequence: 187 a.a.     [Download]
>gi|226947069|ref|YP_002802142.1| unnamed protein product [Azotobacter vinelandii DJ]
MAESTQHKLDRIRPPRVQITYDVETGNAIEKKELPLVVGILADLSGKPEKPLPKLMERRFVEINRDNFND
VLASIAPRAALQVDNTLSQDGSKLNIELHFDHIDDFDPVNIVRQVTPLRRLFEARQRLRDLLTKLDGNDD
LDKLLQDVVANTEGLQEIRSARPQAENPAGAPGAEPAADEPAAEPQA
 
Nucleotide Sequence: 564 bp     [Download]
>gi|226942170|ref|NC_012560.1|:5149261-5149824 Azotobacter vinelandii DJ chromosome, complete genome
ATGGCCGAGAGTACGCAGCACAAGCTCGACAGGATTCGTCCGCCCCGCGTGCAGATCACGTACGACGTGG
AAACCGGGAACGCCATCGAGAAAAAGGAACTCCCGCTGGTGGTCGGCATCCTCGCCGACCTCTCCGGCAA
GCCGGAAAAGCCTCTGCCCAAGCTGATGGAACGGCGCTTCGTCGAGATCAATCGCGACAACTTCAACGAC
GTCCTCGCCTCCATCGCTCCCCGCGCCGCCCTGCAGGTCGACAACACCCTGAGCCAGGACGGCAGCAAGC
TGAACATCGAACTGCATTTCGACCACATCGACGACTTCGATCCGGTCAACATCGTCCGGCAGGTGACCCC
GCTGCGCCGGCTGTTCGAGGCGCGCCAGCGCCTGCGCGACCTGCTCACCAAGCTCGACGGCAACGACGAC
CTGGACAAGCTGCTGCAGGACGTCGTGGCCAACACCGAAGGGCTGCAGGAGATCAGGTCGGCCCGTCCGC
AGGCCGAGAACCCGGCGGGCGCGCCCGGCGCCGAGCCGGCCGCCGACGAACCGGCAGCGGAACCGCAAGC
CTGA