SecReT6
Protein ID: 226947070
SecReT6 ID334
T6SS typei4a
Gene symbol-
Locus tagAvin_50810
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]5149857..5151338 [+]
Producthypothetical protein
NoteTssC
UniProt IDC1DM91
KEGG IDavn:Avin_50810
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.90E-187, Aligned region: 66..488
Protein Sequence: 493 a.a.     [Download]
>gi|226947070|ref|YP_002802143.1| unnamed protein product [Azotobacter vinelandii DJ]
MAQPSAGETQASENITLSLLDRIIAEGRMAHDDSQQDYARDMLAEFATQVLDEGMAIDKDTVSMINDRIA
QIDALIGAQLDEILHHPELQKLEASWRGLHMLVKNTETGARLKLRLLNVTQKELLIDLEKAVEFDQSALF
KKIYEEEYGTFGGHPFSLLVGDYSFGRHPQDIGLLEKLSNVAAAAHAPFIAAASPRLFDMGSFTELAVPR
DLAKIFESQELIKWRAFRESEDSRYVSLVLPHVLLRLPYGPDTCPVEGMDYVEDVNGRDHARYLWGNAAW
ALTQRITEAFARYGWCAAIRGVEGGGAVEGLPAHSFRTSSGDLSLKCPTEVAITDRREKELDALGFIALC
HKKNSDLAVFFGSQTTNRPRVYNTNEANANARISAMLPYVLAASRFAHYLKVIMRDKVGSFMTRDNVQTY
LNNWIADYVLINDNAPQEIKAQYPLREARVDVSEVVGKPGVYRATVFLRPHFQLEELTASIRLVATLPPP
AAA
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|226942170|ref|NC_012560.1|:5149857-5151338 Azotobacter vinelandii DJ chromosome, complete genome
ATGGCCCAGCCGTCCGCCGGCGAGACCCAAGCCAGCGAGAACATCACCCTGTCCCTGCTCGACCGCATCA
TCGCCGAGGGCCGCATGGCCCACGACGACAGCCAGCAGGACTACGCCCGCGACATGCTCGCGGAGTTCGC
CACCCAGGTCCTCGACGAAGGCATGGCCATCGACAAGGACACCGTGTCGATGATCAACGACCGCATCGCC
CAGATCGATGCGCTGATCGGCGCCCAGCTCGACGAAATCCTCCACCATCCCGAGTTGCAGAAGCTGGAAG
CCTCCTGGCGCGGCCTGCACATGCTGGTGAAGAACACCGAGACCGGCGCGCGTCTGAAGCTGCGCCTGCT
CAACGTGACCCAGAAGGAACTGCTGATCGATCTGGAGAAGGCCGTCGAGTTCGACCAGAGCGCGCTGTTC
AAGAAGATCTACGAGGAAGAGTACGGCACCTTCGGCGGGCATCCGTTCAGCCTGCTGGTCGGCGACTACA
GCTTCGGCCGCCATCCGCAGGACATCGGCCTGCTGGAAAAGCTCTCCAACGTCGCCGCCGCCGCCCATGC
GCCCTTCATCGCCGCGGCCAGCCCGCGCCTGTTCGACATGGGCAGTTTCACCGAACTGGCGGTGCCGCGC
GATCTGGCGAAGATCTTCGAGAGCCAGGAACTGATCAAGTGGCGCGCCTTCCGCGAGAGCGAGGATTCGC
GCTACGTCTCCCTGGTGCTGCCGCACGTCCTCCTGCGCCTGCCCTACGGACCGGACACCTGCCCGGTGGA
AGGCATGGACTACGTCGAGGATGTCAACGGCCGCGACCACGCCAGGTACCTCTGGGGCAATGCCGCCTGG
GCCCTGACCCAGCGCATCACCGAGGCCTTCGCCCGCTATGGCTGGTGCGCGGCGATTCGCGGCGTGGAAG
GCGGCGGCGCGGTCGAGGGCCTGCCGGCGCACAGCTTCCGCACCAGCTCCGGCGACCTGTCGCTGAAATG
CCCGACCGAGGTGGCGATCACCGACCGTCGCGAAAAGGAACTCGACGCACTCGGCTTCATCGCCCTCTGC
CACAAGAAGAACAGCGACCTGGCGGTGTTCTTCGGCAGCCAGACGACCAACAGGCCCAGGGTCTACAACA
CCAACGAGGCCAACGCCAACGCCCGTATCTCGGCGATGCTGCCCTATGTCCTGGCCGCCTCGCGCTTCGC
CCACTATCTCAAGGTGATCATGCGCGACAAGGTCGGCAGCTTCATGACCCGCGACAACGTGCAGACCTAC
CTGAACAATTGGATCGCCGACTACGTGCTGATCAACGACAACGCCCCGCAGGAGATCAAGGCGCAGTATC
CGCTGCGCGAAGCGCGGGTGGACGTTTCGGAAGTCGTCGGCAAACCGGGCGTCTATCGCGCCACGGTGTT
CCTCCGCCCGCACTTCCAACTGGAAGAGCTGACCGCCTCGATCCGCCTGGTCGCCACGCTGCCGCCGCCG
GCCGCGGCCTGA