SecReT6
Protein ID: 226947071
SecReT6 ID334
T6SS typei4a
Gene symbol-
Locus tagAvin_50820
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]5151416..5151913 [+]
Producthypothetical protein
NoteTssD
UniProt IDC1DM92
KEGG IDavn:Avin_50820
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.70E-36, Aligned region: 10..139
Protein Sequence: 165 a.a.     [Download]
>gi|226947071|ref|YP_002802144.1| unnamed protein product [Azotobacter vinelandii DJ]
MDAIILDLGDDIKGDSQIEGYTDKIELMSYSHNVAMQVTNDISNSERTSGKPHIGEFTVTKFVDTSTPSL
NEYCCAGKAIPEVKITVGRNAAESDGKILPFIVYTLNNVVLSNVSVSGGAGGKPVETLSLNFTKIKWELT
AQKNDGSKEGTAASTWDLAANKVVK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|226942170|ref|NC_012560.1|:5151416-5151913 Azotobacter vinelandii DJ chromosome, complete genome
ATGGATGCGATCATTCTCGACCTCGGCGACGACATCAAAGGCGACAGCCAGATCGAAGGCTACACCGACA
AGATCGAGCTGATGTCCTACAGCCACAACGTGGCCATGCAAGTCACCAACGACATCAGCAACTCGGAGCG
TACCTCCGGCAAGCCGCACATCGGCGAATTCACCGTCACCAAGTTCGTCGATACCTCGACTCCCTCGCTC
AACGAATACTGCTGCGCCGGCAAGGCCATCCCCGAGGTGAAGATCACCGTCGGCCGCAACGCCGCCGAGA
GCGACGGCAAGATCCTGCCCTTCATCGTCTACACCCTGAACAACGTGGTGCTCTCCAACGTCAGCGTCAG
CGGCGGGGCGGGCGGCAAGCCGGTCGAGACGCTGTCGCTCAACTTCACCAAGATCAAGTGGGAGCTGACC
GCGCAGAAGAACGATGGCAGCAAGGAAGGCACGGCCGCCTCGACCTGGGACCTGGCCGCCAACAAGGTCG
TCAAGTAA