SecReT6
Protein ID: 226947072
SecReT6 ID334
T6SS typei4a
Gene symbol-
Locus tagAvin_50830
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]5151929..5152381 [+]
Producthypothetical protein
NoteTssE
UniProt IDC1DM93
KEGG IDavn:Avin_50830
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.20E-21, Aligned region: 30..125
Protein Sequence: 150 a.a.     [Download]
>gi|226947072|ref|YP_002802145.1| unnamed protein product [Azotobacter vinelandii DJ]
MGASGTGIRPPLFERLAATAEDRGSADFDRQALADSVRGELLRLLNTRRGSRPLTTPASVLDYGIADWSA
LQAERSADRRQLSREIRDAILRFEPRLQPGEIELLSIEGQRQRLRVRLNGVLRGGERCWPVSFLIEDGAD
GFEVRHERLD
 
Nucleotide Sequence: 453 bp     [Download]
>gi|226942170|ref|NC_012560.1|:5151929-5152381 Azotobacter vinelandii DJ chromosome, complete genome
ATGGGCGCCTCCGGCACGGGCATCCGGCCGCCGCTGTTCGAGCGGCTGGCCGCCACGGCGGAAGACCGCG
GCAGCGCGGATTTCGACCGGCAAGCGCTGGCCGACTCGGTGCGCGGCGAGCTGCTGCGGCTACTCAACAC
CCGCCGCGGCTCGCGGCCGCTCACCACCCCGGCGAGCGTGCTCGACTACGGCATCGCCGACTGGAGCGCG
CTGCAGGCCGAACGCAGCGCCGACCGCCGGCAGTTGAGCCGGGAAATCCGCGACGCCATCCTGCGGTTCG
AACCGCGCCTGCAACCGGGCGAAATCGAGCTGCTGTCCATCGAGGGCCAGCGCCAGCGACTGCGCGTGCG
CCTGAACGGCGTCCTGCGCGGCGGGGAGCGGTGCTGGCCGGTGTCGTTCCTGATCGAGGACGGCGCGGAC
GGTTTCGAGGTGCGCCATGAGCGACTCGATTGA