SecReT6
Protein ID: 226947073
SecReT6 ID334
T6SS typei4a
Gene symbol-
Locus tagAvin_50840
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]5152365..5154158 [+]
Producthypothetical protein
NoteTssF
UniProt IDC1DM94
KEGG IDavn:Avin_50840
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-179, Aligned region: 9..593
Protein Sequence: 597 a.a.     [Download]
>gi|226947073|ref|YP_002802146.1| unnamed protein product [Azotobacter vinelandii DJ]
MSDSIDEVLLDYYQRELTWLRHAGAIFAERYPKVARRLELSPGECPDPHVERLLEGFSLLAARLQRRLDD
DYAEFSDALLEQLYPLALRPLPSCAIVQFEPDPTKGNLAEGYRLPRDTPLFVTGADGASVHFRTSAEVEL
WPLQIVEATLLAGDEACALTGVAPARSALRLSLRCLGGCRWPELPVRRLRLHLAASPMVNASLHDLLGAH
ALQMLAGVPGSLPQALPGLPQAVGFSAAEALLPDEDGLHPGLRLLAEYFAFPDKFAFFDLPVQAPSGASE
ELQLYIVFDRAPAGRLHLQAADFALGCAPLVNLFPRTSEPLRPDGTRSEYRLVADSHRENSMEIHSIRAL
RACSAEGVRQVPAYHGCQHALGESRLYWHARRVDGLTPNRLGSDLLLSLVDTRFDPQREAPDYSLTAELL
CTSRHLAEALGAGTRLDFERPGPVARARLRNPPTPQSLPRLRGESRWRLVSQLSLNHLSLVEGERALDAL
KEMLQLHNLRDEPGARRQIDGLVRLDCERIVAQVGEDAWRGWRNGLGVRLHLDPQHFVGSSAVLFSAVLA
QFFSLYASANRFVRTTLVLADKEIKTWQPQAGMPLVL
 
Nucleotide Sequence: 1794 bp     [Download]
>gi|226942170|ref|NC_012560.1|:5152365-5154158 Azotobacter vinelandii DJ chromosome, complete genome
ATGAGCGACTCGATTGACGAGGTCCTGCTCGACTACTACCAGCGCGAACTGACCTGGCTGCGGCATGCCG
GCGCCATTTTCGCCGAGCGCTATCCCAAGGTCGCCCGACGCCTGGAGCTGTCTCCCGGCGAGTGCCCGGA
CCCCCATGTGGAACGCCTGCTGGAAGGCTTCTCCCTGCTCGCCGCGCGCCTGCAGCGGCGCCTCGACGAC
GACTACGCCGAGTTCAGCGACGCCCTGCTGGAACAGTTGTATCCGCTGGCCCTGCGCCCTTTGCCCTCCT
GCGCCATCGTCCAGTTCGAGCCGGACCCGACCAAGGGCAATCTCGCCGAGGGTTATCGCTTGCCGCGCGA
TACCCCGCTGTTCGTCACCGGCGCCGACGGCGCCAGCGTGCACTTCCGCACCAGCGCCGAGGTCGAGCTG
TGGCCGCTGCAGATCGTCGAGGCGACCCTCCTCGCCGGCGACGAAGCCTGCGCCCTGACCGGCGTGGCGC
CGGCCCGTTCGGCCCTGCGCCTGAGCCTGCGCTGCCTGGGCGGGTGCCGCTGGCCGGAGCTGCCCGTGCG
TCGCCTGCGCCTGCATCTGGCTGCGTCACCGATGGTCAACGCCAGCCTCCACGACCTGCTGGGCGCCCAT
GCCCTGCAGATGCTCGCCGGAGTGCCGGGCAGCCTGCCGCAGGCTTTGCCCGGGTTGCCGCAGGCGGTCG
GCTTTTCCGCCGCCGAAGCCTTGCTGCCGGACGAGGACGGACTGCACCCCGGTCTGCGTCTTCTGGCCGA
ATACTTCGCCTTCCCGGACAAGTTCGCCTTCTTCGACCTGCCCGTGCAGGCGCCGTCCGGCGCGAGCGAA
GAACTCCAGTTGTACATCGTCTTCGACCGCGCCCCGGCCGGCCGGCTACATCTGCAGGCGGCCGACTTCG
CTCTCGGCTGCGCGCCGCTGGTCAACCTGTTCCCGCGCACCTCGGAGCCGCTGCGCCCGGACGGCACCCG
CAGCGAATACCGGCTGGTCGCCGACAGCCACCGGGAAAACAGCATGGAGATCCACAGCATCCGCGCGCTG
CGCGCCTGCTCGGCAGAGGGCGTGCGCCAGGTGCCGGCCTACCATGGCTGCCAGCACGCCCTCGGCGAGA
GCCGCCTCTACTGGCACGCCCGCCGCGTCGACGGGCTGACGCCGAACCGCCTGGGCAGCGACCTGCTGCT
GAGCCTGGTCGACACCCGTTTCGACCCGCAGCGCGAGGCGCCCGACTACAGCTTGACCGCCGAGCTGCTG
TGCACCAGCCGACACCTCGCCGAGGCTCTGGGCGCCGGTACCCGGCTGGATTTCGAGCGCCCCGGCCCGG
TGGCCCGCGCCCGCCTGCGCAATCCGCCGACGCCGCAAAGCCTGCCGCGCCTGCGCGGCGAATCGCGCTG
GCGGCTGGTCTCGCAACTGAGCCTCAACCACCTGTCGCTGGTGGAGGGAGAACGGGCCCTGGACGCACTC
AAGGAAATGCTCCAGTTGCACAACCTGCGCGACGAGCCCGGCGCGCGCCGGCAGATCGACGGCCTGGTTC
GCCTCGACTGCGAACGCATCGTCGCCCAAGTCGGCGAGGACGCCTGGCGCGGCTGGCGCAACGGCCTGGG
CGTGCGCCTGCATCTCGACCCGCAGCATTTCGTCGGCAGCAGCGCCGTGCTGTTCTCCGCCGTCCTCGCG
CAGTTCTTCTCGCTCTACGCCAGCGCCAATCGCTTCGTGCGCACCACGCTGGTCCTGGCCGACAAGGAGA
TCAAGACGTGGCAGCCACAGGCCGGAATGCCGCTCGTCCTCTGA