SecReT6
Protein ID: 226947074
SecReT6 ID334
T6SS typei4a
Gene symbol-
Locus tagAvin_50850
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]5154122..5155144 [+]
Producthypothetical protein
NoteTssG
UniProt IDC1DM95
KEGG IDavn:Avin_50850
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.40E-81, Aligned region: 18..320
Protein Sequence: 340 a.a.     [Download]
>gi|226947074|ref|YP_002802147.1| unnamed protein product [Azotobacter vinelandii DJ]
MAATGRNAARPLSERLRREPQAFELLQALLLLEREQPRATPLGSGTAPRAEALRLRGPLTPLFAASQVQS
LENDRQDARPVLSTPVFGLGGPDGPLPYAYQEWLQQRARQKDHGPGEFLDLFQHRLLSLLYRSLRKHRVA
LGFEAPQNSPVHDQLRALTGLLPKGLRERQSLPDAAILARGALFADGRRSLAGFAAVVRQHFRLPVRAEP
YQGAWRPIPPAARSILGRGRRNLSLGRDAVAGTRIWDEHAGIRLTLGPLEPARAEAFLPDGDAHRQLACL
AALHFGPDLDCALRLLVSGARPLLLDRRAPPRLNWNGGLRRQPCAAIRHFDTRLRLPEMS
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|226942170|ref|NC_012560.1|:5154122-5155144 Azotobacter vinelandii DJ chromosome, complete genome
GTGGCAGCCACAGGCCGGAATGCCGCTCGTCCTCTGAGCGAGCGCCTGCGCCGCGAGCCGCAGGCCTTCG
AGCTGCTGCAGGCACTGCTGCTGCTCGAACGCGAACAGCCGCGGGCGACGCCGCTCGGCAGCGGCACGGC
GCCGCGCGCCGAGGCGCTGCGTCTGCGCGGGCCGCTGACGCCGCTGTTCGCCGCCAGCCAGGTGCAGAGT
CTGGAGAACGACCGACAGGACGCACGACCGGTACTGAGCACTCCGGTGTTCGGCCTCGGCGGTCCCGACG
GCCCACTGCCCTACGCCTACCAGGAATGGCTGCAGCAACGGGCGCGGCAGAAGGACCACGGCCCCGGCGA
ATTTCTCGACCTGTTCCAGCACCGCCTGCTCAGCCTGCTGTACCGCAGCCTGCGCAAGCACCGTGTCGCC
CTGGGCTTCGAGGCGCCGCAGAACAGCCCGGTACACGATCAGTTGCGCGCCCTGACCGGCTTGCTGCCCA
AGGGCCTGCGCGAGCGCCAGAGCCTGCCGGACGCGGCGATCCTCGCCCGCGGCGCGCTGTTCGCCGACGG
CCGCCGCTCGCTGGCCGGCTTCGCCGCCGTCGTCCGCCAGCATTTCCGCCTGCCGGTGCGGGCCGAGCCC
TACCAGGGCGCCTGGCGCCCCATCCCGCCGGCCGCTCGCAGCATCCTCGGTCGCGGTCGCCGCAACCTGA
GCCTGGGTCGCGACGCCGTGGCCGGTACCCGGATCTGGGACGAGCACGCCGGCATCCGCCTGACCCTCGG
CCCTCTGGAGCCGGCGCGGGCCGAGGCGTTCCTGCCGGACGGCGACGCCCACCGGCAACTCGCCTGCCTG
GCCGCCCTCCACTTCGGCCCGGACCTGGACTGCGCGCTGCGCCTGCTGGTCAGTGGCGCCCGGCCGCTGT
TGCTCGATCGCCGGGCGCCGCCGCGGCTGAACTGGAACGGCGGTCTGCGCCGCCAGCCCTGCGCGGCCAT
CCGCCACTTCGATACCCGACTGCGCCTGCCGGAGATGAGTTGA