SecReT6
Protein ID: 226947076
SecReT6 ID334
T6SS typei4a
Gene symbol-
Locus tagAvin_50870
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]5158418..5160424 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDC1DM97
KEGG IDavn:Avin_50870
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.70E-70, Aligned region: 30..323
Phage_GPD [PF05954], Evalue: 6.70E-70, Aligned region: 568..610
Phage_base_V [PF04717], Evalue: 1.10E-22, Aligned region: 95..117
Phage_base_V [PF04717], Evalue: 1.10E-22, Aligned region: 351..444
Gp5_C [PF06715], Evalue: 1.40E-11, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 1.40E-11, Aligned region: 526..532
Gp5_C [PF06715], Evalue: 1.40E-11, Aligned region: 536..557
Gp5_C [PF06715], Evalue: 1.40E-11, Aligned region: 560..583
Gp5_C [PF06715], Evalue: 1.40E-11, Aligned region: 641..654
Protein Sequence: 668 a.a.     [Download]
>gi|226947076|ref|YP_002802149.1| unnamed protein product [Azotobacter vinelandii DJ]
MPRPTDITTSLSLTTSALANLFPEQLSGEERLNGLGSLQLHSYSAAAPTLDSVVATHLTATLHNDADLRP
LDALIAEVRQLPGDASADRYQVLLRPWLWWLTLASNNRVFQNKTTGEIVTGIFDGHGFGDYRLKLSGSYT
PREYCVQYSETDFAFVSRLLEEEGIFWFFTHEEGRHTLVLADGNDAFPAIPNGPKVPYLSQEIGVRELHG
VRSAQYCIQAVAGAYSATDYEFTTPTTSLYSRAEALAGSFSSYEHPGGYIAKARGDALTKQRVDGLRSQE
KRLIGESDCRWLVPGHWFTLTGHDDANLNIDWVVTSVTHEASHEHYRNRFEAIPKATNYRPPRATPKPRM
HTQTARVVGKAGEEIWTDQYGRIKIQFPWDREGRNDETSSCWVRVVLPWSGKNFGMQFVPRIGQEVIVTF
IDGDPDRPLVTGCVYNGDNALPYALPANQTQSGIKTNSSKGGGGFNELRFEDKKDAEEVFLQAQKDLKIN
VLNDSTASVGHDETLTVQNARTRTVKDGDETVTLEKGNRSVTLQTGSDTLDVRDSRTVKVGSDQTHSTGG
DYSHTVTGDYSLTVNGNLTIKVSGTLTLQSSGDFTARSDLSLTQQAGTSISQKAGTSFANQAGTSLDNKA
GTTLVNDAGISLTNKAGAEQTVDGGGLLTLKGGLVKIN
 
Nucleotide Sequence: 2007 bp     [Download]
>gi|226942170|ref|NC_012560.1|:5158418-5160424 Azotobacter vinelandii DJ chromosome, complete genome
ATGCCCCGTCCCACCGACATTACTACCAGCCTTTCTCTGACCACTTCGGCCCTGGCGAATCTGTTTCCGG
AGCAGCTCTCCGGCGAGGAGCGGCTGAACGGCCTCGGTAGCCTGCAGTTGCACAGCTATAGCGCCGCCGC
ACCGACGCTGGACAGCGTGGTGGCTACGCACCTGACCGCGACGCTGCACAACGATGCCGACTTGCGCCCG
CTGGACGCGCTAATCGCGGAAGTCCGCCAATTGCCCGGCGACGCGAGCGCCGACCGTTACCAAGTACTCC
TGCGCCCTTGGCTCTGGTGGCTGACCCTGGCCAGCAACAACCGGGTGTTCCAGAACAAGACCACGGGCGA
GATCGTCACCGGCATCTTCGATGGCCATGGCTTCGGCGATTACCGGTTGAAGCTCTCCGGCAGCTACACG
CCGCGCGAGTACTGCGTGCAGTACAGCGAGACGGATTTCGCCTTCGTCTCGCGGCTGCTGGAGGAGGAAG
GCATCTTCTGGTTCTTCACCCATGAAGAGGGCAGGCACACCCTGGTGCTGGCCGACGGCAACGATGCCTT
CCCAGCGATCCCCAACGGGCCGAAAGTACCCTATCTGAGCCAGGAAATCGGCGTGCGCGAGCTGCACGGC
GTGCGTTCGGCGCAGTACTGCATCCAGGCGGTGGCCGGGGCCTACAGTGCGACCGACTACGAATTCACCA
CGCCCACTACCTCGCTCTACAGCCGGGCCGAGGCGCTGGCCGGGTCATTTTCCAGCTACGAGCATCCCGG
CGGCTACATCGCCAAGGCGCGCGGCGACGCGCTGACCAAGCAGCGGGTGGACGGCCTGCGCAGCCAGGAA
AAGCGCCTGATCGGCGAGAGCGACTGCCGCTGGCTGGTGCCGGGGCACTGGTTCACCCTCACCGGACACG
ACGACGCCAACCTGAACATCGACTGGGTGGTGACCTCGGTGACCCACGAGGCCAGCCACGAGCACTACCG
CAACCGCTTCGAGGCGATCCCGAAGGCCACCAACTACCGTCCCCCGCGCGCGACGCCCAAGCCACGCATG
CACACCCAGACGGCCAGGGTGGTCGGCAAGGCCGGCGAGGAGATCTGGACCGACCAGTACGGCCGGATCA
AGATCCAGTTCCCCTGGGACCGCGAGGGGCGGAACGACGAGACCAGTTCCTGCTGGGTGCGCGTGGTATT
GCCCTGGAGCGGCAAGAACTTCGGCATGCAGTTCGTTCCGCGCATCGGCCAGGAGGTGATCGTCACCTTC
ATCGACGGCGATCCGGACCGGCCGCTGGTCACCGGCTGCGTCTACAACGGCGACAACGCCCTGCCCTACG
CGCTGCCGGCCAACCAGACGCAATCGGGCATCAAGACCAATTCGTCCAAGGGCGGCGGCGGTTTCAACGA
GCTGCGCTTCGAGGACAAGAAGGATGCCGAGGAGGTCTTCCTGCAGGCGCAGAAGGACCTGAAGATCAAC
GTGCTCAACGACAGCACGGCCAGCGTCGGCCACGACGAGACGCTGACGGTGCAGAACGCCCGCACCCGCA
CGGTGAAGGACGGCGACGAGACCGTCACCCTGGAAAAGGGCAACCGTAGCGTCACCCTGCAGACCGGCAG
CGATACCCTGGACGTCAGGGACAGCCGTACGGTGAAGGTCGGCAGCGACCAGACCCACAGCACCGGCGGC
GACTACAGCCACACGGTGACCGGCGACTACAGCCTGACGGTGAACGGCAATCTGACCATCAAGGTGAGCG
GCACCCTGACCCTGCAGAGCAGCGGCGACTTCACCGCCAGGAGCGACCTGTCGCTGACCCAGCAGGCCGG
TACCTCGATCAGCCAGAAGGCCGGCACCTCCTTCGCCAACCAGGCCGGTACCTCGCTGGACAACAAGGCC
GGCACCACCCTGGTCAACGACGCCGGCATCAGCCTGACCAACAAGGCCGGCGCCGAGCAGACGGTGGATG
GCGGCGGCCTGCTGACCCTCAAGGGCGGCCTGGTCAAGATCAACTGA