SecReT6
Protein ID: 227119289
SecReT6 ID487
T6SS typeN/A
Gene symbol-
Locus tagVC395_A0102
StrainVibrio cholerae O395
Repliconchromosome II [GenBank: NC_012583] [Browse all T6SS(s) in this replicon]
Location [Strand]118906..119331 [+]
Producthypothetical protein
NoteTssE
UniProt IDA5F1D9
KEGG IDvcr:VC395_A0102, vco:VC0395_0029
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-16, Aligned region: 37..123
Protein Sequence: 141 a.a.     [Download]
>gi|227119289|ref|YP_002821184.1| hypothetical protein VC395_A0102 [Vibrio cholerae O395]
MTYIAPEESAFGVGFFERLEANAKPMSLTRGPDAWDVLESIKRNVSNILNTRIGGAQSAPHLGLVDFNDA
TLETLDLSVRIKLAIQQCLERYEPRLTRADQDSFNSLTLRFHITATINSEALHEKVQFSLLLDQSRKYRV
F
 
Nucleotide Sequence: 426 bp     [Download]
>gi|227119188|ref|NC_012583.1|:118906-119331 Vibrio cholerae O395 chromosome chromosome II, complete sequence
ATGACGTACATCGCACCTGAAGAGAGTGCATTTGGTGTTGGCTTTTTCGAACGTTTGGAAGCCAACGCCA
AACCTATGTCGCTGACCCGTGGGCCAGACGCGTGGGATGTACTCGAATCGATCAAACGGAATGTCTCTAA
CATTCTGAACACTCGAATTGGTGGAGCGCAAAGTGCCCCTCATCTCGGGTTGGTGGATTTTAATGATGCA
ACGCTGGAAACCTTAGATCTCTCCGTGCGAATTAAATTGGCGATTCAACAGTGCCTTGAGCGCTATGAGC
CGCGTTTAACTCGAGCGGATCAAGATAGCTTTAACTCGCTGACTTTAAGGTTCCACATTACCGCGACCAT
CAATAGCGAAGCGTTACACGAAAAAGTCCAGTTCAGTCTGTTATTGGATCAAAGCAGAAAATATCGAGTG
TTTTAA