SecReT6
Protein ID: 227119290
SecReT6 ID487
T6SS typeN/A
Gene symbol-
Locus tagVC395_A0103
StrainVibrio cholerae O395
Repliconchromosome II [GenBank: NC_012583] [Browse all T6SS(s) in this replicon]
Location [Strand]119337..121106 [+]
Producthypothetical protein
NoteTssF
UniProt IDA5F1D8
KEGG IDvco:VC0395_0028, vcr:VC395_A0103
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-209, Aligned region: 5..589
Protein Sequence: 589 a.a.     [Download]
>gi|227119290|ref|YP_002821185.1| hypothetical protein VC395_A0103 [Vibrio cholerae O395]
MTQDKYFREELAFLKEQGKEFTEIHPQLSRFLHGRTTDPDVERLLEGFAFLTARLREKVEDEFPELTHSI
INMLWPNYLRPIPSMSVVAFEPDKSVSEKQVIPRNTQLDSKPVFGTACHFNTCRDVALYPMQCQGVHAEH
TREATTIQISLRMLGDMTVGDAKLDTVRFYLGGDKYSSQTLYLWLHHYLQKMTIEVQGVEFALPADAFST
VGFSSDQALLPYPKNVYDGYRILQEYLSFPEAFHFFDVKGFAKALPKAVSGDFTLRIHFSKTLPADTRVR
QDNFQLYCTPVINLFEHDADPIDLTGRRSEYRIVPSSRYPAHYEIFSVDQVVGWQDTQSEGKRIRGEKRI
YSSFESFQHEVERVRHRQALYYRTRVKESIRGDGFDSFISFVRGDETLSMGVDEAVSIKLTCTNRLLPLE
LGVGDICVATDSSPPFATFKNITVPSQSLRPVLDGSLLWTLISNLSLNYLSLLSKDALSCVLRAYDFRAL
VDRQAERVARMRLDGIVKIESKPVDKILRGLPVRGLQSTLYVDQAGFGSEGDLFLFGTVLSHFFALYASI
NSFHELVVVNISNQEKYSWGTQSGMQPLI
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|227119188|ref|NC_012583.1|:119337-121106 Vibrio cholerae O395 chromosome chromosome II, complete sequence
ATGACGCAAGACAAGTATTTCAGGGAAGAGCTCGCTTTTTTAAAAGAGCAGGGGAAAGAATTTACCGAAA
TTCACCCTCAGCTTTCGCGTTTTCTTCATGGCCGTACGACCGATCCTGACGTTGAGCGTCTTTTGGAAGG
TTTTGCATTTCTTACCGCGCGTTTGCGCGAAAAGGTGGAGGATGAGTTCCCTGAACTTACTCACTCCATC
ATTAACATGCTGTGGCCAAATTATCTGCGCCCTATCCCGAGCATGAGTGTGGTGGCGTTTGAACCTGACA
AAAGTGTCAGCGAGAAGCAAGTCATCCCACGTAATACCCAATTGGATAGCAAGCCAGTCTTTGGCACGGC
GTGTCATTTCAACACTTGCCGTGATGTCGCGCTATATCCGATGCAGTGTCAAGGTGTTCATGCCGAGCAC
ACACGTGAAGCCACGACCATTCAGATCTCGTTGCGCATGTTGGGCGATATGACAGTAGGCGACGCTAAGC
TCGATACCGTACGTTTTTACTTAGGTGGTGATAAATACAGCTCGCAAACTCTCTATCTTTGGTTACACCA
TTATCTACAAAAAATGACGATTGAAGTGCAGGGTGTCGAGTTCGCACTGCCTGCTGATGCGTTTTCAACC
GTCGGTTTCTCAAGTGACCAAGCTTTGCTGCCTTATCCAAAGAATGTCTATGACGGTTATCGTATTTTGC
AAGAGTACCTGTCGTTTCCTGAAGCCTTTCACTTCTTTGATGTAAAAGGTTTTGCCAAAGCTTTACCGAA
AGCGGTCAGCGGTGATTTCACCTTACGCATCCATTTTTCGAAAACATTGCCTGCTGATACGCGAGTGCGT
CAGGACAATTTTCAACTCTATTGCACACCGGTCATCAATCTGTTTGAGCATGATGCCGATCCGATCGATT
TGACTGGGCGTCGTTCAGAGTATCGAATCGTCCCGTCCAGTCGCTATCCTGCCCACTATGAAATTTTCAG
CGTGGATCAAGTGGTTGGTTGGCAAGATACCCAGTCAGAAGGCAAACGGATCCGCGGAGAAAAGCGTATC
TACTCTTCTTTTGAAAGCTTCCAACATGAAGTGGAACGGGTTCGTCATCGTCAAGCGCTTTACTATCGCA
CACGAGTCAAAGAGAGCATCCGGGGGGATGGTTTTGATTCATTTATCTCTTTTGTGCGCGGTGATGAAAC
CTTATCAATGGGCGTAGATGAAGCCGTCTCAATCAAACTCACCTGCACCAATCGCTTGCTGCCATTGGAA
CTTGGGGTGGGGGATATTTGTGTGGCGACCGACAGCTCACCCCCTTTTGCCACATTCAAAAATATTACGG
TGCCTTCGCAGTCACTGCGCCCGGTTCTCGATGGCAGCTTACTGTGGACGCTGATCTCGAATCTATCGCT
GAACTACCTATCACTGCTCTCAAAAGATGCACTGAGCTGTGTGCTACGCGCTTACGATTTTCGCGCCTTG
GTCGATAGGCAAGCTGAACGTGTCGCACGGATGCGCCTTGATGGCATAGTCAAAATAGAATCTAAACCGG
TTGATAAAATCCTACGTGGTTTGCCTGTGCGTGGTTTGCAATCGACTTTGTATGTCGATCAAGCGGGATT
TGGCTCGGAAGGTGATTTGTTCCTGTTTGGTACGGTACTCAGTCATTTCTTTGCACTTTACGCCAGCATC
AACTCATTTCACGAATTAGTCGTGGTTAACATCAGCAATCAAGAGAAGTACTCATGGGGCACACAGAGCG
GAATGCAGCCGTTGATCTGA