SecReT6
Protein ID: 227119292
SecReT6 ID487
T6SS typeN/A
Gene symbol-
Locus tagVC395_A0105
StrainVibrio cholerae O395
Repliconchromosome II [GenBank: NC_012583] [Browse all T6SS(s) in this replicon]
Location [Strand]122089..123576 [+]
Producthypothetical protein
NoteFha
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.30E-06, Aligned region: 35..102
Protein Sequence: 495 a.a.     [Download]
>gi|227119292|ref|YP_002821187.1| hypothetical protein VC395_A0105 [Vibrio cholerae O395]
MNSVTLPSLTLLVTNAQHLESGLSAQHTWTSSGGVIGSSPNAQWRLVDAQGSVKPMHCEVMMVDGAYCLK
DSCGSTYVNGADMPLGVGQMARLTHKDEVSVGPYRLRVLFGNAIEVEEQYGSLDALFASKDEDLLADLTL
DIEPEKHELPTNTDPLQALDNLMGAAGSSTSLLDDPKSEQPLSAQPSLVPQDNLVLQNADFTPQADSEYE
MTSSIRLKKILGFAKATFAKQTKSEAPNVTSATPTISQYKTSESNVSEGFTMDEKVLDLLEEEVAKSFQP
QLEKSAYSTMHTSSTSQANHLVTGPILEGLGVDLSDENDMNRMHLLSQELGESLQACVRGLLDLHQQVSE
SRFGTLNRNLQPIEDNPLRLGLSYEKTIRTLYDADKSVVHLSAPAAIAESLKTVRDHNEAMQFATSEALS
QILNAFSPQVMLRRFHHYKRNSDTTQTSTDAWAWNMYCSYYQELTSNRQRGFEKLFWEIFEQAYDRKIRE
KQLEL
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|227119188|ref|NC_012583.1|:122089-123576 Vibrio cholerae O395 chromosome chromosome II, complete sequence
ATGAACTCAGTGACATTACCTTCGTTGACCCTATTAGTCACCAATGCTCAGCACTTAGAGTCTGGCTTGT
CCGCTCAGCATACGTGGACCTCGTCAGGTGGGGTGATCGGCTCATCGCCGAATGCGCAGTGGCGTTTGGT
CGATGCGCAAGGCAGTGTAAAACCCATGCACTGTGAAGTGATGATGGTAGACGGGGCGTATTGTTTAAAA
GACAGCTGCGGCAGCACGTATGTCAACGGGGCAGACATGCCACTGGGCGTTGGGCAAATGGCACGTCTGA
CTCACAAAGATGAAGTGAGTGTGGGGCCTTACCGTTTGCGAGTGCTGTTTGGTAACGCCATCGAAGTGGA
AGAACAATATGGATCTTTAGATGCGCTGTTTGCCTCTAAGGATGAGGATCTGCTAGCGGATTTGACGCTC
GACATCGAACCAGAAAAACACGAATTACCAACCAATACAGACCCATTACAGGCGCTCGATAACCTGATGG
GTGCGGCGGGCAGTTCGACCTCCTTACTGGATGATCCTAAAAGTGAGCAGCCGTTATCCGCCCAACCTAG
CCTCGTGCCACAAGATAACTTAGTGCTGCAAAATGCCGATTTTACGCCACAAGCGGACAGTGAGTATGAG
ATGACCTCATCGATCCGCCTTAAGAAAATTCTTGGTTTTGCGAAGGCCACCTTTGCTAAGCAAACCAAAT
CAGAAGCACCGAACGTGACTTCTGCCACCCCCACAATTTCTCAATATAAAACCAGCGAAAGCAACGTATC
AGAGGGCTTCACAATGGATGAAAAAGTACTGGATTTGTTAGAAGAGGAAGTCGCGAAAAGTTTCCAACCG
CAGTTGGAGAAAAGCGCGTATTCCACTATGCACACAAGCTCAACCAGCCAAGCTAACCACTTGGTGACAG
GTCCGATCTTGGAAGGGCTCGGCGTAGACCTGAGTGATGAAAATGATATGAATCGTATGCATCTTTTATC
GCAAGAGCTGGGTGAGTCTTTGCAAGCTTGTGTGCGCGGTTTACTCGATTTGCATCAACAAGTGAGTGAA
AGCCGTTTCGGTACTTTGAACCGTAATCTGCAACCCATTGAAGATAACCCGCTGCGTTTAGGCCTCTCCT
ATGAAAAGACGATCCGCACTCTGTACGATGCTGATAAGAGCGTCGTGCACCTTTCTGCCCCTGCGGCGAT
TGCTGAAAGCCTAAAAACCGTTCGCGATCATAATGAAGCGATGCAGTTCGCCACGTCAGAAGCCTTGAGC
CAAATTCTCAACGCTTTCTCACCACAGGTGATGCTGCGCCGTTTCCACCACTACAAGCGCAATTCTGATA
CCACACAAACTTCCACGGATGCTTGGGCGTGGAATATGTACTGCAGCTACTACCAAGAGCTGACCTCTAA
CCGCCAACGCGGCTTTGAGAAGTTGTTTTGGGAGATCTTTGAGCAAGCCTACGATCGCAAAATTCGCGAG
AAGCAACTGGAGCTATAA