SecReT6
Protein ID: 227119293
SecReT6 ID487
T6SS typeN/A
Gene symbol-
Locus tagVC395_A0106
StrainVibrio cholerae O395
Repliconchromosome II [GenBank: NC_012583] [Browse all T6SS(s) in this replicon]
Location [Strand]123579..124055 [+]
Producthypothetical protein
NoteTssJ
UniProt IDA5F1D5
KEGG IDvcr:VC395_A0106, vco:VC0395_0025
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.80E-38, Aligned region: 12..148
Protein Sequence: 158 a.a.     [Download]
>gi|227119293|ref|YP_002821188.1| hypothetical protein VC395_A0106 [Vibrio cholerae O395]
MNKVLWMLFALTVLTACSSSDKYEPAKEPTKVTFSLVSDEGVNPNIWGEASPIEIQVFELKDDSMFMSSD
YDQIKTDYKKALRSNFVKNYDYVLTPGQFKFVNAFEVDEETNYIGVMAHFAEPELSEWKKAVKVINKGRE
YHLLMLFKDYDVKLDRVE
 
Nucleotide Sequence: 477 bp     [Download]
>gi|227119188|ref|NC_012583.1|:123579-124055 Vibrio cholerae O395 chromosome chromosome II, complete sequence
GTGAACAAAGTGCTGTGGATGCTGTTTGCCTTGACGGTGCTGACCGCGTGCAGTTCGTCGGATAAGTACG
AGCCTGCGAAAGAGCCGACCAAGGTGACTTTTAGCTTAGTCAGCGATGAAGGGGTGAACCCGAACATCTG
GGGTGAAGCGTCACCGATAGAAATTCAAGTTTTTGAGCTAAAGGATGACTCGATGTTTATGTCGTCCGAC
TACGACCAGATCAAAACCGATTATAAAAAAGCGCTGCGCAGTAACTTTGTTAAAAACTACGACTATGTAC
TGACTCCAGGGCAGTTCAAATTCGTCAACGCTTTCGAAGTCGATGAGGAGACCAACTACATCGGCGTGAT
GGCTCATTTTGCCGAGCCTGAACTCAGCGAATGGAAGAAAGCGGTCAAGGTGATCAATAAAGGGCGAGAG
TATCACTTGCTGATGCTGTTTAAAGACTACGATGTGAAATTGGATAGGGTGGAATAA