SecReT6
Protein ID: 227119294
SecReT6 ID487
T6SS typeN/A
Gene symbol-
Locus tagVC395_A0108
StrainVibrio cholerae O395
Repliconchromosome II [GenBank: NC_012583] [Browse all T6SS(s) in this replicon]
Location [Strand]125401..126174 [+]
Producthypothetical protein
NoteTssL
UniProt IDA5F1D2
KEGG IDvcr:VC395_A0108, vco:VC0395_0022
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-69, Aligned region: 37..242
Protein Sequence: 257 a.a.     [Download]
>gi|227119294|ref|YP_002821189.1| hypothetical protein VC395_A0108 [Vibrio cholerae O395]
MSQSKKETPLASLLFDDVEKINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRTLTECDNIEQIYRQTI
EEIKAIEIELTEQGYEHAILMAYRYILCAFLDESVMGTEWGASSLWAEHSMLSRFHNETWGGEKVFTILS
RLEGEPHRYQALLAFIYHCLILGFEGKYRVMEGGQAEREKVISRLHQLLSSLEESEPQDLTRPTDHVVRA
KYTLSRQMPVWSVFAGFIVLWVGLFLGYSYVLHSKSSDVLNQLNQIL
 
Nucleotide Sequence: 774 bp     [Download]
>gi|227119188|ref|NC_012583.1|:125401-126174 Vibrio cholerae O395 chromosome chromosome II, complete sequence
ATGTCACAGAGTAAAAAAGAGACGCCATTAGCCAGTTTGTTGTTCGACGATGTGGAAAAAATTAACCACG
ACCAAGACTACTGGTTCCAATTGCGTGGGGACAATCCGAATGTGCTGATTGATGCCGCGACACCCTTGTT
TGGGCTTTCTCTGCGGGTTCGTACCCTCACCGAATGCGACAACATTGAACAGATCTACCGTCAGACGATT
GAAGAGATCAAAGCGATTGAAATTGAGTTGACGGAGCAAGGTTACGAACACGCCATTTTGATGGCCTATC
GCTACATCTTGTGCGCCTTTTTGGATGAATCCGTGATGGGAACCGAGTGGGGCGCGTCCAGTTTATGGGC
CGAGCACTCCATGCTGTCACGCTTCCATAATGAAACGTGGGGTGGCGAGAAAGTGTTTACGATTTTGAGC
CGTCTTGAGGGTGAACCACACCGTTACCAAGCGCTATTGGCCTTTATTTATCATTGCCTGATTTTGGGCT
TTGAAGGCAAATACCGTGTGATGGAAGGGGGACAAGCTGAGCGCGAAAAAGTGATCAGCCGCCTGCATCA
ACTGCTGAGCAGCTTGGAAGAGAGCGAGCCACAAGACTTAACCCGTCCGACCGATCATGTGGTGCGTGCG
AAATATACCCTAAGCAGACAGATGCCTGTTTGGTCTGTGTTTGCTGGCTTTATCGTGCTTTGGGTAGGTC
TATTTCTCGGCTACAGCTATGTACTGCATAGCAAATCCAGCGATGTGCTCAATCAACTCAATCAAATACT
TTAA