SecReT6
Protein ID: 227119297
SecReT6 ID487
T6SS typeN/A
Gene symbol-
Locus tagVC395_A0111
StrainVibrio cholerae O395
Repliconchromosome II [GenBank: NC_012583] [Browse all T6SS(s) in this replicon]
Location [Strand]130374..131057 [+]
Producthypothetical protein
NoteVCA0118
UniProt IDA5F1C9
KEGG IDvcr:VC395_A0111, vco:VC0395_0019
PDB IDNA
Domain hit(s) vs Pfam DUF3121 [PF11319], Evalue: 2.40E-58, Aligned region: 41..221
Protein Sequence: 227 a.a.     [Download]
>gi|227119297|ref|YP_002821192.1| hypothetical protein VC395_A0111 [Vibrio cholerae O395]
MPEIGDQNPMRITVLVVSLILGCAGSAHVLAASQDAGSQVEQAELCREIPARLERLACFDRVFATPLEQV
AIAPSNPYPAEWQRAMVALSESQSEAGWVLGTQGEGRGSSAWIALPAQNRSSGETSPPVLLLSCINNLSR
IELALPKEVADARIQVSIRHETQFWRSDDHGVLFSSARGMPAIEMMKLAASESRLLLRSNAPFADGLQFD
TRGVNEALDALRERCGW
 
Nucleotide Sequence: 684 bp     [Download]
>gi|227119188|ref|NC_012583.1|:130374-131057 Vibrio cholerae O395 chromosome chromosome II, complete sequence
GTGCCTGAAATTGGAGATCAAAACCCCATGAGAATTACCGTTTTAGTGGTCAGTTTGATCTTGGGTTGCG
CGGGCTCTGCGCATGTTTTAGCAGCATCGCAAGATGCGGGCTCACAGGTTGAGCAAGCTGAGCTGTGCCG
CGAAATTCCTGCGCGTTTAGAGCGTTTGGCTTGTTTTGACCGTGTCTTTGCCACGCCCCTTGAGCAAGTG
GCTATCGCACCGTCCAATCCTTATCCCGCAGAGTGGCAACGCGCCATGGTGGCATTGTCTGAGTCGCAGT
CCGAAGCGGGTTGGGTATTAGGTACGCAAGGTGAAGGGCGGGGCAGCAGCGCTTGGATTGCTTTGCCTGC
GCAAAATCGCAGCTCAGGGGAAACATCTCCGCCAGTGCTCTTGCTCAGTTGCATTAATAACCTGAGCCGC
ATTGAGCTGGCTTTACCGAAAGAAGTGGCTGATGCACGGATTCAAGTCTCTATCCGACACGAGACACAGT
TCTGGCGCAGTGACGATCACGGCGTACTGTTTTCCTCGGCTCGCGGCATGCCTGCGATCGAAATGATGAA
ATTGGCCGCCAGTGAGTCTCGCCTGTTGCTGCGTTCTAATGCGCCCTTTGCTGACGGGTTACAGTTTGAT
ACTCGAGGTGTCAATGAAGCCCTTGATGCTTTGCGCGAACGCTGTGGTTGGTAA