SecReT6
Protein ID: 227119298
SecReT6 ID487
T6SS typeN/A
Gene symbol-
Locus tagVC395_A0112
StrainVibrio cholerae O395
Repliconchromosome II [GenBank: NC_012583] [Browse all T6SS(s) in this replicon]
Location [Strand]131067..132476 [+]
Producthypothetical protein
NoteTssA
UniProt IDA5F1C8
KEGG IDvcr:VC395_A0112, vco:VC0395_0018
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-16, Aligned region: 49..109
PPDK_N [PF01326], Evalue: 0.0077, Aligned region: 81..199
Protein Sequence: 469 a.a.     [Download]
>gi|227119298|ref|YP_002821193.1| hypothetical protein VC395_A0112 [Vibrio cholerae O395]
MEMTEYRQCVAKPISSSNPVGERLVDHPLFDFIEDQMMKVGSLSHASVQWDEVEHSTLKLLGEQSKDIKL
LVYLLQCLHNQVTPTRLITSFAVMSEFLNQYWNDSYPAPGPRGNLPRRKFFSQMAQRFTTVIEKFDFHHL
DEADRQALQAAVEEWQQAVEKQGLSSELVESVVVRITAEIKRAEQRQQVTAQSSAERETPSAATPSPAAS
MVVDHSSDKAAKQTLLKVADFLAEQEFGIALSIRLRRFAVWGSITSLPDHKPDGETLLRGMQADRVKDYQ
DQLRHPDLALWRKVEQSLTMAPYWFEGQWMSYTIAQQLGKSDWCQAIAEETQQFLRRLPSLLELKFKGGE
PFVSDSVKEWLASVGQSQGAAGQSVGGDWQEKRKEAFQLAKEGGIAVALSMLNDGLVSAVEPRDKFYWRL
LSADLLRANHLDAMAGEQYQTLLNQVTTLSVPEWEPSLVEQIQRYTTSE
 
Nucleotide Sequence: 1410 bp     [Download]
>gi|227119188|ref|NC_012583.1|:131067-132476 Vibrio cholerae O395 chromosome chromosome II, complete sequence
ATGGAAATGACTGAATACCGTCAGTGTGTGGCCAAACCGATCAGCAGTAGCAATCCTGTCGGAGAGCGGC
TAGTCGATCACCCACTGTTTGATTTTATTGAGGATCAGATGATGAAAGTGGGCTCTCTCTCTCACGCTTC
AGTGCAGTGGGATGAAGTGGAGCACAGCACTCTCAAACTGCTTGGTGAACAGAGTAAAGACATCAAGCTT
TTGGTTTACCTGCTGCAGTGTCTGCATAACCAAGTTACCCCGACGCGCCTTATTACCTCGTTTGCGGTGA
TGAGTGAGTTCCTCAATCAATATTGGAACGACAGTTATCCAGCGCCGGGCCCACGTGGCAATCTGCCGCG
ACGTAAATTTTTCAGCCAGATGGCGCAACGTTTTACCACGGTGATCGAAAAGTTCGATTTTCATCATCTG
GATGAAGCGGATCGCCAAGCGCTACAAGCGGCGGTTGAAGAGTGGCAACAAGCCGTTGAGAAACAAGGGC
TCTCTTCTGAGTTGGTGGAGTCTGTGGTGGTGCGAATTACCGCGGAGATCAAACGCGCAGAGCAGCGCCA
GCAAGTGACGGCGCAAAGCAGCGCGGAGCGTGAAACACCAAGTGCTGCAACGCCTTCTCCTGCGGCGAGT
ATGGTGGTGGATCATTCGAGTGACAAAGCAGCGAAACAAACCCTACTCAAAGTGGCAGATTTTCTTGCCG
AACAAGAGTTTGGTATCGCTCTTTCGATTCGTCTGCGCCGCTTTGCGGTGTGGGGCAGCATTACCTCATT
GCCCGATCATAAACCCGATGGTGAAACACTGCTGCGTGGAATGCAGGCGGATCGCGTCAAGGATTACCAA
GATCAACTTCGTCACCCCGATTTAGCCTTGTGGCGCAAAGTCGAACAGAGCTTAACCATGGCTCCTTATT
GGTTTGAAGGACAGTGGATGAGTTACACCATTGCCCAGCAACTCGGCAAAAGTGATTGGTGTCAGGCGAT
TGCCGAAGAAACACAACAGTTTTTACGTCGTTTGCCTTCGCTGCTTGAGCTCAAATTCAAAGGCGGAGAG
CCGTTTGTCAGCGATTCGGTCAAAGAGTGGCTGGCGAGCGTAGGTCAGAGCCAAGGTGCTGCGGGGCAAT
CGGTCGGCGGAGATTGGCAAGAGAAGCGTAAAGAGGCGTTTCAACTGGCTAAAGAAGGTGGAATCGCGGT
GGCACTTTCCATGCTCAATGATGGCTTGGTCAGTGCGGTGGAGCCGCGAGACAAATTTTACTGGCGATTG
CTATCGGCAGATCTGCTGCGGGCAAATCATCTCGATGCGATGGCTGGTGAACAGTATCAAACTCTGCTCA
ATCAGGTAACGACGCTGTCTGTTCCTGAGTGGGAACCGAGTTTAGTGGAACAAATTCAAAGATATACAAC
GTCAGAGTAA